SecReT4
Protein ID: 49188558
T4SS name [ID]VirB [431]
Gene symbolvirD4
Locus tagPMA4326A38
StrainPseudomonas syringae pv. maculicola plasmid pPMA4326A (NC_005918)
Repliconplasmid pPMA4326A [GenBank: NC_005918] [Browse all T4SS(s) in this replicon]
Location [Strand]31626..33299 [+]
ProductVirD4
Component typeVirD4
UniProt IDQ6J2G6
KEGG IDNA
PDB IDNA
Domain hit(s) vs Pfam T4SS-DNA_transf [PF02534], Evalue: 7.1e-73, Aligned region: 26..477
TraG-D_C [PF12696], Evalue: 1.9e-24, Aligned region: 313..438
TrwB_AAD_bind [PF10412], Evalue: 2.1e-16, Aligned region: 313..458
Protein Sequence: 557 a.a.     [Download]
>gi|49188558|ref|YP_025656.1| VirD4 [Pseudomonas syringae pv. maculicola]
MGKAKQQPISPDNPQERIEEHPAILIGKHPTKDTFLASYGQTFVMLAAPPGTGKTVGVVTPNLLSYPDSV
VVNDPKFENWRDTAGFRAAAGHKVYRFSPELLETHRWNPLSALSRDPLYRLGQIRTLAGVLFVSDNPKNQ
EWYNKAANVFAAILLYLMEMEGMKLNGMKLTLPQAYEVASLGTGLGVWAQQAIEQHSTGPNALSVETLRE
LNGVFEASKNKSSGWSTTVDILRGALSMYAEKTVAWAVSDTDIDFTKLRKEKISIYFCVTGNAIKKYGPL
MNLFFTQAIQQNTDVMPEQGGHCADGTLILKYQVLFVIDEIAVMGRIEIMEMAPALTRGAGLRYIIIFQG
KDQLRSERTYGREAGNGIMQAFHIEIVYGTGNVELAKEYSTRLGNTTVRVHNQSLNRQKHEIGARGQTDS
YSEQPRPLLLPQEVSALPYGEELIFVEATKTTPAANIRARKIFWYEEPVFKERAGMPTPDVPIGDASKID
ALTVPVRTVEAKVAVADTKPMQAEQRQRWNPKDKASEVAQAEAAKAQPPEVEPDPEPAQADDTPETM
 
Nucleotide Sequence: 1674 bp     [Download]
>gi|49188520|ref|NC_005918.1|:31626-33299 Pseudomonas syringae pv. maculicola strain ES4326 plasmid pPMA4326A, complete sequence
ATGGGCAAAGCCAAACAACAACCCATCAGCCCGGACAATCCCCAAGAACGGATCGAGGAGCACCCCGCGA
TCCTCATTGGCAAACACCCCACCAAGGACACCTTTTTAGCCAGCTATGGCCAGACGTTCGTCATGCTGGC
CGCGCCCCCTGGCACCGGCAAAACGGTGGGAGTCGTTACCCCCAATCTATTGAGCTACCCCGATTCGGTG
GTAGTGAACGACCCCAAGTTCGAAAACTGGAGGGACACGGCAGGTTTTCGGGCCGCAGCCGGACACAAGG
TCTACCGTTTTTCGCCCGAGCTTCTGGAGACGCACCGCTGGAACCCGCTGAGCGCCCTCAGCCGCGACCC
GCTGTACCGTTTGGGGCAGATACGCACGCTGGCGGGTGTGCTGTTCGTGTCGGACAACCCCAAGAACCAG
GAGTGGTACAACAAGGCTGCCAACGTGTTTGCGGCCATCTTGCTGTACCTGATGGAAATGGAGGGCATGA
AGCTCAATGGTATGAAGCTGACCTTGCCCCAGGCCTATGAGGTGGCGTCACTGGGCACCGGGCTCGGTGT
GTGGGCGCAGCAAGCCATCGAGCAACACAGCACTGGCCCCAACGCGCTGTCAGTGGAAACCCTTCGTGAG
CTCAATGGCGTGTTCGAGGCCTCGAAGAACAAGAGCAGCGGATGGTCTACCACCGTCGATATCTTGCGCG
GTGCCTTGTCCATGTATGCCGAGAAAACGGTGGCCTGGGCAGTCTCAGACACCGACATTGACTTCACCAA
GCTGCGCAAGGAGAAGATCAGCATCTACTTTTGCGTGACCGGTAACGCGATCAAGAAATACGGCCCGCTG
ATGAACCTGTTCTTCACTCAGGCCATTCAGCAGAACACCGATGTGATGCCCGAGCAGGGTGGTCATTGCG
CAGATGGCACGTTGATACTCAAGTATCAGGTGTTGTTCGTGATCGACGAAATCGCGGTCATGGGCCGTAT
CGAGATCATGGAAATGGCCCCGGCGCTGACACGCGGTGCAGGCCTTCGCTACATCATCATTTTTCAGGGC
AAGGACCAGCTGCGCAGCGAGCGCACGTATGGCCGGGAGGCTGGCAACGGCATCATGCAGGCCTTTCACA
TCGAAATCGTCTACGGCACCGGCAATGTCGAGCTGGCCAAGGAGTACAGCACGCGCCTGGGCAACACCAC
GGTGCGCGTCCATAACCAGTCGTTGAACAGACAGAAGCATGAAATCGGTGCTCGAGGTCAAACAGACAGT
TACAGCGAACAGCCCCGACCGTTGCTGTTGCCGCAGGAGGTCAGCGCCCTGCCTTATGGCGAAGAGCTGA
TTTTTGTGGAAGCCACAAAGACGACGCCCGCTGCCAACATCCGAGCCCGGAAAATCTTCTGGTACGAAGA
ACCCGTGTTCAAAGAGCGAGCCGGTATGCCGACGCCCGATGTGCCGATTGGCGATGCTTCCAAAATCGAC
GCGCTCACCGTGCCGGTGCGCACTGTCGAAGCCAAGGTGGCAGTGGCCGACACCAAGCCCATGCAGGCCG
AACAGCGGCAGCGCTGGAATCCCAAAGACAAAGCGTCCGAAGTGGCTCAGGCCGAAGCGGCCAAGGCTCA
GCCCCCCGAGGTCGAGCCGGATCCCGAGCCTGCGCAGGCTGACGATACCCCCGAAACGATGTAG
 Primer design