SecReT4
Protein ID: 49474583
T4SS name [ID]VirB [31]
Gene symbol-
Locus tagBQ10580
StrainBartonella quintana str. Toulouse
Repliconchromosome [GenBank: NC_005955] [Browse all T4SS(s) in this replicon]
Location [Strand]1255047..1255361 [+]
Producthypothetical protein
Component typeVirB7
UniProt IDG8K041
KEGG IDbqu:BQ10580
PDB IDNA
Domain hit(s) vs Pfam NA
Protein Sequence: 104 a.a.     [Download]
>gi|49474583|ref|YP_032625.1| hypothetical protein BQ10580 [Bartonella quintana str. Toulouse]
MKRKITFFMILMIALTGCASLSGPKKPPRCNGQYTRALNRDKWDWDNKNIIIQKKIVKPVTTPIILNTLE
SEKATADVTLHPASLDSINHEKFSDQNTEIAREK
 
Nucleotide Sequence: 315 bp     [Download]
>gi|49473688|ref|NC_005955.1|:1255047-1255361 Bartonella quintana str. Toulouse, complete genome
ATGAAACGAAAAATAACTTTTTTTATGATCCTGATGATTGCCCTTACGGGTTGTGCTTCTCTTAGTGGGC
CCAAAAAACCACCACGATGTAATGGCCAGTATACGCGCGCTTTAAATAGAGATAAGTGGGATTGGGACAA
TAAAAACATCATCATACAAAAAAAAATCGTAAAACCTGTTACAACCCCCATCATCCTCAACACGCTGGAA
AGTGAAAAAGCAACAGCTGACGTGACGCTTCATCCAGCTTCATTGGATTCTATAAATCATGAAAAATTCT
CTGATCAAAATACGGAAATCGCTCGTGAAAAGTGA
 Primer design