SecReT4
Protein ID: 49474584
T4SS name [ID]VirB [31]
Gene symbolvirB8
Locus tagBQ10590
StrainBartonella quintana str. Toulouse
Repliconchromosome [GenBank: NC_005955] [Browse all T4SS(s) in this replicon]
Location [Strand]1255351..1256019 [+]
ProductvirB8 protein
Component typeVirB8
UniProt IDQ6FYW3
KEGG IDbqu:BQ10590
PDB IDNA
Domain hit(s) vs Pfam VirB8 [PF04335], Evalue: 2.1e-60, Aligned region: 12..219
Protein Sequence: 222 a.a.     [Download]
>gi|49474584|ref|YP_032626.1| virB8 protein [Bartonella quintana str. Toulouse]
MKSDAFDEYVKEARSFDIDRMHSLQQRMRIAMTLTVLFGLMTIALALAVAALTPLKTVEPFVIRVDNSTG
IIETVSALKETPNNYDEAITRYFAGKYVRAREGFQLSEAEYNFRLISLLSSPEEQNRFAKWYSGNNPESP
QNIYHNMTAKVTIKSISFLSKDLIQVRYYKTIRELNGKENISHWVSILNFSYINAHISTEDRLINPLGFQ
VSEYRSDPEVIK
 
Nucleotide Sequence: 669 bp     [Download]
>gi|49473688|ref|NC_005955.1|:1255351-1256019 Bartonella quintana str. Toulouse, complete genome
GTGAAAAGTGATGCATTTGATGAATATGTAAAAGAAGCACGCTCATTTGATATTGATCGCATGCATAGCC
TACAACAGCGAATGAGAATTGCCATGACTTTGACAGTGCTTTTTGGCTTGATGACAATCGCCTTGGCTTT
GGCTGTAGCAGCATTAACACCCTTAAAAACAGTAGAGCCCTTTGTTATCCGCGTTGATAATTCAACAGGT
ATTATTGAGACAGTAAGTGCCTTAAAAGAAACGCCAAACAATTATGATGAAGCAATAACACGTTATTTTG
CTGGCAAATATGTTCGTGCGCGCGAAGGTTTTCAATTATCAGAGGCGGAATACAATTTTCGCTTGATTTC
TCTTTTATCTTCACCAGAAGAACAAAACCGTTTTGCAAAATGGTATTCGGGCAACAATCCAGAAAGTCCG
CAAAATATCTATCACAACATGACTGCTAAGGTCACAATCAAGTCAATCTCCTTTTTAAGCAAAGATCTTA
TTCAAGTGCGTTACTATAAAACGATCAGAGAATTGAATGGAAAAGAAAATATTTCCCATTGGGTCTCGAT
CCTCAATTTTTCCTACATTAATGCACACATTTCAACAGAAGACCGACTAATCAACCCGCTTGGTTTTCAA
GTGTCAGAATATCGATCTGATCCAGAGGTGATAAAATGA
 Primer design