SecReT4
Protein ID: 49474587
T4SS name [ID]VirB [31]
Gene symbolvirB11
Locus tagBQ10620
StrainBartonella quintana str. Toulouse
Repliconchromosome [GenBank: NC_005955] [Browse all T4SS(s) in this replicon]
Location [Strand]1258029..1259099 [+]
ProductvirB11 protein
Component typeVirB11
UniProt IDQ6FYW0
KEGG IDbqu:BQ10620
PDB IDNA
Domain hit(s) vs Pfam T2SE [PF00437], Evalue: 2.6e-94, Aligned region: 20..333
FtsK_SpoIIIE [PF01580], Evalue: 7.8e-05, Aligned region: 180..203
Protein Sequence: 356 a.a.     [Download]
>gi|49474587|ref|YP_032629.1| virB11 protein [Bartonella quintana str. Toulouse]
MNQNLHKLSNETVAIVLTKLEPISAFLKDKSLFEIVINRPYQVMTEGIEGWKTIEAPALSFDELMGIAKV
VASYSKQKISDKNPILSATLPGNERIQIVIPPAVEKDTISMTIRKPSSRNFSLEELANKGLFSVCEQVSF
TPLNDYQSRFSELKHIEHSLATAYSNKDFVSFLNQAVKCQKNILIAGKTGSGKTTLSKALIAKIPDNERI
ITIEDTPELVVPQPNYVSMIYSKDGQGLASVGPKELLESALRMRPDRILLQELRDGTAFYYIRNINSGHP
GSITTVHASTALAAFEQMTLLVKESEGGGDLERDDIRGLLISMIDIIVQCKRVEGKFKVTEIYYDPFKQR
NIFGGN
 
Nucleotide Sequence: 1071 bp     [Download]
>gi|49473688|ref|NC_005955.1|:1258029-1259099 Bartonella quintana str. Toulouse, complete genome
ATGAACCAAAACCTGCATAAATTGAGCAATGAAACTGTCGCGATTGTTTTAACAAAACTTGAACCCATCA
GTGCCTTTCTGAAAGATAAGAGCCTTTTTGAAATTGTCATCAATCGTCCCTATCAAGTGATGACAGAAGG
TATTGAGGGATGGAAAACAATAGAAGCACCAGCTCTTTCGTTTGATGAGCTTATGGGAATTGCTAAAGTT
GTCGCTTCCTATTCTAAGCAAAAGATATCCGACAAAAATCCAATATTATCGGCTACCCTACCGGGGAATG
AACGTATTCAAATTGTCATTCCTCCTGCAGTGGAAAAAGACACAATCAGCATGACAATTCGCAAACCATC
ATCGCGGAATTTTTCACTCGAAGAGCTGGCAAATAAAGGTCTCTTTTCTGTGTGTGAACAAGTGTCATTT
ACGCCATTGAATGATTATCAATCGCGTTTTAGTGAACTCAAACACATTGAGCATAGCTTGGCAACCGCTT
ATTCTAATAAGGATTTTGTCTCCTTTTTAAATCAAGCTGTAAAATGCCAAAAAAATATTTTAATTGCAGG
GAAAACGGGTTCTGGTAAAACAACGCTATCAAAGGCATTAATCGCTAAAATTCCCGATAATGAGCGTATT
ATCACCATTGAAGATACACCAGAATTGGTCGTACCACAGCCCAATTATGTCTCTATGATCTATTCAAAAG
ATGGTCAAGGCTTAGCCTCTGTTGGTCCAAAAGAATTGCTTGAATCTGCTTTGCGCATGCGTCCTGATCG
CATTCTTCTACAAGAGCTTCGAGATGGTACAGCCTTTTATTATATCCGCAATATCAATTCAGGACATCCA
GGTTCAATTACCACGGTTCATGCATCAACAGCACTCGCTGCATTTGAGCAAATGACCCTCTTGGTCAAAG
AAAGTGAAGGCGGAGGTGATTTAGAGCGTGATGATATTCGAGGGCTGTTGATTTCAATGATTGATATCAT
TGTTCAATGCAAACGGGTTGAAGGAAAATTTAAGGTCACAGAAATTTATTATGACCCGTTTAAACAACGA
AACATCTTTGGAGGGAATTAA
 Primer design