SecReT4
Protein ID: 49474588
T4SS name [ID]VirB [31]
Gene symboltraG
Locus tagBQ10640
StrainBartonella quintana str. Toulouse
Repliconchromosome [GenBank: NC_005955] [Browse all T4SS(s) in this replicon]
Location [Strand]1261086..1263005 [+]
Productconjugal transfer protein TraG
Component typeVirD4
UniProt IDQ6FYV9
KEGG IDbqu:BQ10640
PDB IDNA
Domain hit(s) vs Pfam T4SS-DNA_transf [PF02534], Evalue: 1.4e-102, Aligned region: 157..636
TraG-D_C [PF12696], Evalue: 4.5e-29, Aligned region: 475..593
TrwB_AAD_bind [PF10412], Evalue: 1.2e-21, Aligned region: 317..609
Protein Sequence: 639 a.a.     [Download]
>gi|49474588|ref|YP_032630.1| conjugal transfer protein TraG [Bartonella quintana str. Toulouse]
MKYTKIQLALILMPIALGALTIFLVPHLLSFMINDLKANHVYWYVRSEPLLVLMLVATVSLCYTLSQKLH
LRKAITLVSAVFFGITALYFIGGEIKRLTPYVGQQGITWSYALKFMDPMVVFGVICGVVLLVIQVMISSP
PTSKVKRAKKGIFGDASWMNLKEAAKIFPANGQIVVGERYRVDQDGVCNIPFAPGNKTTWGKGGTAPLLT
FNLDFGSTHMIFFAGSGGYKTTSTVVPTCLTYPGPIVCLDPSTEIAPMVRFARKKMGNRNVIVLDPNSLL
TKNFNVLDWLLDDSVPRTQREANIVGFSKLLLTDKKSENSSAEYFSTQAHNLLTALLAHVIFSDEYEDSE
RNLKTLRAILSQSETAVVNQLRMIQETTPSPFIREMVGIFTEMADQTFSGVYTTASKDTQWLSLSNYADL
VCGNDFSSSDIANGKTDVFLNLPASILNSYPAIGRVIIGAFLNAMVTADGKYKKRVLFVLDEVDLLGYMN
ILEEARDRGRKYGTSLMLFYQSSGQLVNHFGEAGARSWFESCSFVSYAAIKDLQTAKDISERCGQMTVEV
TGTNKSRGLSLGKSSYNVNYQQRALILPHEIIQEMRQDEQIILMQGQPPLRCGRAIYFRRKEMLAAANKN
RFAPQAKKN
 
Nucleotide Sequence: 1920 bp     [Download]
>gi|49473688|ref|NC_005955.1|:1261086-1263005 Bartonella quintana str. Toulouse, complete genome
ATGAAATACACAAAGATACAGCTGGCGCTTATTTTAATGCCAATCGCTTTAGGTGCTTTAACGATATTCC
TTGTCCCGCATTTATTGTCATTTATGATCAATGATTTGAAAGCCAATCATGTTTACTGGTATGTTCGTTC
AGAGCCCTTATTGGTGCTGATGCTGGTTGCTACTGTGTCATTATGTTATACCCTATCGCAAAAGCTGCAC
CTGCGCAAAGCAATCACGCTGGTCTCCGCTGTCTTTTTTGGGATCACTGCTCTTTACTTTATTGGCGGTG
AAATAAAACGCTTAACTCCCTATGTTGGGCAACAAGGGATAACATGGAGCTATGCTCTCAAGTTCATGGA
TCCTATGGTTGTTTTTGGCGTCATTTGTGGCGTTGTTCTTTTAGTAATTCAAGTCATGATAAGCTCTCCG
CCCACAAGCAAAGTCAAGCGTGCGAAAAAAGGAATTTTTGGGGATGCCTCATGGATGAATTTAAAAGAAG
CAGCAAAAATTTTTCCCGCCAATGGTCAAATTGTTGTTGGCGAAAGATACCGTGTTGACCAAGACGGTGT
GTGCAATATTCCCTTTGCGCCTGGCAATAAAACAACATGGGGAAAAGGGGGAACAGCCCCTTTGCTTACC
TTTAATCTTGATTTTGGTTCAACCCACATGATCTTTTTTGCCGGTTCTGGTGGGTATAAAACAACAAGTA
CAGTTGTTCCGACCTGTTTAACATATCCAGGACCTATTGTTTGCCTTGATCCTTCAACAGAAATTGCGCC
AATGGTTAGGTTTGCGCGGAAAAAAATGGGCAATAGAAATGTTATTGTTCTCGATCCCAATTCCCTCTTA
ACAAAAAATTTTAATGTACTTGATTGGCTTTTAGACGATAGCGTACCGCGCACACAACGTGAAGCTAATA
TTGTCGGTTTTTCCAAACTGCTTCTTACGGATAAAAAATCAGAGAATTCTTCGGCAGAATATTTTTCGAC
ACAAGCACATAATCTTTTAACTGCGCTTCTTGCACATGTCATCTTCTCTGATGAATATGAAGATAGTGAG
CGCAATTTAAAAACATTGCGCGCGATCCTTTCTCAGTCAGAAACGGCTGTTGTGAATCAATTGCGCATGA
TTCAAGAAACAACACCTTCTCCTTTTATTCGTGAAATGGTTGGTATTTTCACCGAAATGGCAGACCAAAC
CTTTTCAGGGGTCTATACAACGGCATCAAAAGATACCCAGTGGCTTTCTTTGTCCAATTACGCTGATCTT
GTTTGTGGCAATGATTTTTCGTCTTCGGATATTGCAAATGGAAAGACAGATGTTTTTCTGAATCTTCCTG
CAAGCATTTTGAACAGTTATCCAGCGATTGGACGCGTGATTATTGGCGCTTTTTTAAATGCGATGGTTAC
GGCTGACGGAAAATATAAAAAGCGTGTTTTGTTTGTCTTGGATGAAGTTGATCTTCTTGGTTATATGAAT
ATTTTAGAGGAAGCACGCGACCGTGGGCGTAAATACGGCACATCCTTGATGCTCTTTTATCAATCCTCTG
GTCAGTTGGTCAATCACTTTGGAGAAGCGGGGGCGCGTTCATGGTTTGAAAGTTGCTCATTTGTCAGTTA
CGCCGCCATTAAAGATCTCCAAACAGCCAAAGATATTTCAGAGCGCTGTGGTCAAATGACGGTTGAAGTA
ACCGGAACAAACAAATCGAGAGGTTTGTCTTTGGGAAAGAGCTCTTACAACGTCAATTATCAACAAAGAG
CCTTGATTTTACCCCATGAAATTATTCAGGAAATGCGCCAAGATGAACAAATCATCCTTATGCAAGGACA
ACCCCCTTTACGATGTGGTCGAGCGATTTACTTTAGAAGAAAAGAAATGTTAGCCGCTGCTAACAAAAAC
CGTTTTGCTCCACAAGCAAAGAAAAATTAA
 Primer design