SecReT4
Protein ID: 49474732
T4SS name [ID]Trw [145]
Gene symboltrwN
Locus tagBQ12470
StrainBartonella quintana str. Toulouse
Repliconchromosome [GenBank: NC_005955] [Browse all T4SS(s) in this replicon]
Location [Strand]1463341..1463961 [+]
ProducttrwN protein
Component typeTrwN
UniProt IDQ6FYK1
KEGG IDbqu:BQ12470
PDB IDNA
Domain hit(s) vs Pfam NA
Protein Sequence: 206 a.a.     [Download]
>gi|49474732|ref|YP_032774.1| trwN protein [Bartonella quintana str. Toulouse]
MIVPSFMVLAAAYAPSIHPTIFSAQPFTFEEAFATTEKFKQSGHNFGISLGQINVKNLKWFSMSCLISCV
NLFDFCKNLKAVRIVLTHCYERAVSEYNSEQTTLQTALNFYNRGSFKSGLSSAYVQKIASHVAAEAPALL
SEKPQQSVQFSTRKSEQTMKTEALPSSSEELEDAFTHKTSSVRDAFTTENSSLATEDSSSFEREQE
 
Nucleotide Sequence: 621 bp     [Download]
>gi|49473688|ref|NC_005955.1|:1463341-1463961 Bartonella quintana str. Toulouse, complete genome
ATGATTGTTCCAAGCTTTATGGTGCTCGCTGCTGCATACGCACCGTCTATTCATCCTACAATATTTTCAG
CTCAACCTTTCACGTTTGAAGAAGCATTTGCAACAACTGAAAAATTTAAGCAGAGCGGACATAATTTTGG
CATAAGTTTGGGACAAATTAACGTCAAAAATTTGAAGTGGTTCAGTATGTCTTGCTTGATTAGCTGCGTC
AATTTGTTTGATTTCTGTAAAAATCTCAAAGCTGTACGAATTGTTCTGACACACTGCTATGAACGTGCAG
TGTCGGAGTACAACTCTGAACAAACTACGTTGCAAACTGCACTAAACTTTTATAACAGGGGAAGCTTTAA
GAGCGGTTTGAGCAGCGCTTATGTGCAGAAAATTGCCTCACATGTTGCAGCAGAAGCGCCTGCACTTCTT
AGTGAAAAACCGCAACAATCTGTACAGTTTAGCACAAGAAAATCAGAACAAACAATGAAGACAGAAGCTC
TTCCTTCCTCTTCCGAAGAATTGGAGGATGCCTTTACGCATAAGACAAGCAGCGTTCGTGATGCTTTCAC
AACAGAAAATTCCTCTTTAGCGACAGAGGATTCTTCGTCCTTCGAAAGAGAACAAGAGTAA
 Primer design