SecReT4
Protein ID: 49474734
T4SS name [ID]Trw [145]
Gene symboltrwL1
Locus tagBQ12490
StrainBartonella quintana str. Toulouse
Repliconchromosome [GenBank: NC_005955] [Browse all T4SS(s) in this replicon]
Location [Strand]1464361..1464678 [+]
Productconjugal transfer protein TrwL
Component typeTrwL
UniProt IDQ6FYJ9
KEGG IDbqu:BQ12490
PDB IDNA
Domain hit(s) vs Pfam TrbC [PF04956], Evalue: 1.4e-19, Aligned region: 6..99
Protein Sequence: 105 a.a.     [Download]
>gi|49474734|ref|YP_032776.1| conjugal transfer protein TrwL [Bartonella quintana str. Toulouse]
MKRSNMIKIAVRNRITATVTAMIVFLITHPIYTQAQDLTRVKTALETFRDQLKTIIPVAAALILLCLAIG
YAGRYIEKDTFIRWAIGVVIAGSATQIATILFKAG
 
Nucleotide Sequence: 318 bp     [Download]
>gi|49473688|ref|NC_005955.1|:1464361-1464678 Bartonella quintana str. Toulouse, complete genome
ATGAAACGATCAAATATGATTAAAATAGCGGTTCGTAATAGGATTACTGCAACTGTAACGGCTATGATTG
TGTTTCTCATAACTCATCCTATATATACTCAAGCACAGGATTTGACGAGAGTAAAAACTGCTTTAGAGAC
ATTCCGAGATCAATTGAAGACGATTATTCCTGTTGCTGCTGCCCTTATCCTTTTATGCTTAGCAATCGGT
TATGCAGGACGATATATCGAAAAAGATACATTCATACGGTGGGCAATCGGCGTTGTCATCGCTGGTTCAG
CAACCCAAATCGCCACTATATTGTTTAAAGCTGGATAA
 Primer design