SecReT4
Protein ID: 49474734
T4SS name [ID]Trw [145]
Gene symboltrwL1
Locus tagBQ12490
StrainBartonella quintana str. Toulouse
Repliconchromosome [GenBank: NC_005955] [Browse all T4SS(s) in this replicon]
Location [Strand]1464361..1464678 [+]
Productconjugal transfer protein TrwL
Component typeTrwL
UniProt IDQ6FYJ9
KEGG IDbqu:BQ12490
PDB IDNA
Domain hit(s) vs Pfam TrbC [PF04956], Evalue: 1.4e-19, Aligned region: 6..99
Protein Sequence: 105 a.a.     [Download]
>gi|49474734|ref|YP_032776.1| conjugal transfer protein TrwL [Bartonella quintana str. Toulouse]
MKRSNMIKIAVRNRITATVTAMIVFLITHPIYTQAQDLTRVKTALETFRDQLKTIIPVAAALILLCLAIG
YAGRYIEKDTFIRWAIGVVIAGSATQIATILFKAG
 
Nucleotide Sequence: 318 bp     [Download]
>gi|49473688|ref|NC_005955.1|:1464361-1464678 Bartonella quintana str. Toulouse, complete genome
ATGAAACGATCAAATATGATTAAAATAGCGGTTCGTAATAGGATTACTGCAACTGTAACGGCTATGATTG
TGTTTCTCATAACTCATCCTATATATACTCAAGCACAGGATTTGACGAGAGTAAAAACTGCTTTAGAGAC
ATTCCGAGATCAATTGAAGACGATTATTCCTGTTGCTGCTGCCCTTATCCTTTTATGCTTAGCAATCGGT
TATGCAGGACGATATATCGAAAAAGATACATTCATACGGTGGGCAATCGGCGTTGTCATCGCTGGTTCAG
CAACCCAAATCGCCACTATATTGTTTAAAGCTGGATAA
 Primer design

Protein ID: 49474735
T4SS name [ID]Trw [145]
Gene symboltrwL2
Locus tagBQ12500
StrainBartonella quintana str. Toulouse
Repliconchromosome [GenBank: NC_005955] [Browse all T4SS(s) in this replicon]
Location [Strand]1464840..1465160 [+]
Productconjugal transfer protein TrwL
Component typeTrwL
UniProt IDQ6FYJ8
KEGG IDbqu:BQ12500
PDB IDNA
Domain hit(s) vs Pfam TrbC [PF04956], Evalue: 3.8e-23, Aligned region: 2..102
Protein Sequence: 106 a.a.     [Download]
>gi|49474735|ref|YP_032777.1| conjugal transfer protein TrwL [Bartonella quintana str. Toulouse]
MKRLNNLQSRSNDKSIAIAAATTVFFMAHPVYAQVSGLNNAKTVLEKLKTELTTTIIPIAAALILLCLAI
GYAGRYIEKDTFIRWAIGVIIAGSATQIATMLFKAT
 
Nucleotide Sequence: 321 bp     [Download]
>gi|49473688|ref|NC_005955.1|:1464840-1465160 Bartonella quintana str. Toulouse, complete genome
ATGAAGCGATTGAATAATCTACAATCAAGAAGTAACGACAAAAGCATCGCAATTGCTGCAGCTACGACCG
TGTTCTTTATGGCTCATCCTGTGTATGCGCAAGTGAGCGGTTTAAATAACGCTAAAACTGTTCTAGAAAA
GCTGAAGACTGAACTTACTACGACAATTATACCTATCGCTGCTGCTCTTATCCTTTTATGCTTAGCAATC
GGTTATGCAGGACGCTATATCGAAAAAGATACATTCATACGGTGGGCAATCGGTGTTATCATCGCTGGTT
CAGCAACTCAAATCGCCACAATGCTTTTTAAAGCTACATAG
 Primer design

Protein ID: 49474736
T4SS name [ID]Trw [145]
Gene symboltrwL3
Locus tagBQ12510
StrainBartonella quintana str. Toulouse
Repliconchromosome [GenBank: NC_005955] [Browse all T4SS(s) in this replicon]
Location [Strand]1465203..1465505 [+]
Productconjugal transfer protein TrwL
Component typeTrwL
UniProt IDQ6FYJ7
KEGG IDbqu:BQ12510
PDB IDNA
Domain hit(s) vs Pfam TrbC [PF04956], Evalue: 4.8e-20, Aligned region: 6..97
Protein Sequence: 100 a.a.     [Download]
>gi|49474736|ref|YP_032778.1| conjugal transfer protein TrwL [Bartonella quintana str. Toulouse]
MKRPNIKIAVYNKTIAAMTVFIMTHPVYAQAQTLDTAKSALSKFRTELNNIIPIAAALILLCLAIGYAGR
YIEKDTFIRWAVGVVIAGSATQIANMLFSS
 
Nucleotide Sequence: 303 bp     [Download]
>gi|49473688|ref|NC_005955.1|:1465203-1465505 Bartonella quintana str. Toulouse, complete genome
ATGAAACGACCAAACATTAAAATAGCAGTTTATAATAAAACCATCGCAGCTATGACTGTATTTATTATGA
CTCACCCTGTGTATGCCCAAGCACAAACTTTAGATACAGCAAAAAGTGCTTTAAGTAAGTTTCGGACTGA
ATTGAACAATATTATTCCTATTGCTGCTGCCCTTATCCTTTTATGCTTAGCAATCGGTTATGCAGGACGC
TATATCGAAAAAGATACATTCATACGGTGGGCAGTCGGCGTTGTTATCGCTGGTTCAGCAACTCAAATTG
CTAATATGTTGTTCTCAAGTTAA
 Primer design

Protein ID: 49474737
T4SS name [ID]Trw [145]
Gene symboltrwL4
Locus tagBQ12520
StrainBartonella quintana str. Toulouse
Repliconchromosome [GenBank: NC_005955] [Browse all T4SS(s) in this replicon]
Location [Strand]1465636..1465953 [+]
Productconjugal transfer protein TrwL
Component typeTrwL
UniProt IDQ6FYJ6
KEGG IDbqu:BQ12520
PDB IDNA
Domain hit(s) vs Pfam TrbC [PF04956], Evalue: 4.9e-23, Aligned region: 1..102
Protein Sequence: 105 a.a.     [Download]
>gi|49474737|ref|YP_032779.1| conjugal transfer protein TrwL [Bartonella quintana str. Toulouse]
MKQLDNLQSKSNNKIIAIAAAITVLFMAYPAYAQVQALSNAKNVLESLQSELTTKIIPIAAALILLCLAI
GYAGRYIEKDTFIRWAVGVIIAGSATQIATMLFKP
 
Nucleotide Sequence: 318 bp     [Download]
>gi|49473688|ref|NC_005955.1|:1465636-1465953 Bartonella quintana str. Toulouse, complete genome
ATGAAACAATTAGACAACCTACAATCAAAAAGTAATAACAAAATCATTGCAATTGCCGCAGCTATAACTG
TACTTTTTATGGCTTATCCTGCGTATGCTCAAGTACAAGCTTTAAGTAACGCTAAAAATGTTCTAGAAAG
CCTGCAGAGTGAACTTACTACGAAAATTATACCTATTGCTGCTGCCCTCATACTTTTATGCTTAGCAATT
GGTTATGCAGGACGCTATATCGAAAAAGATACATTCATACGGTGGGCAGTCGGCGTTATCATCGCTGGTT
CAGCAACCCAAATCGCCACAATGCTTTTTAAACCTTGA
 Primer design

Protein ID: 49474738
T4SS name [ID]Trw [145]
Gene symboltrwL5
Locus tagBQ12530
StrainBartonella quintana str. Toulouse
Repliconchromosome [GenBank: NC_005955] [Browse all T4SS(s) in this replicon]
Location [Strand]1466119..1466433 [+]
Productconjugal transfer protein TrwL
Component typeTrwL
UniProt IDQ6FYJ5
KEGG IDbqu:BQ12530
PDB IDNA
Domain hit(s) vs Pfam TrbC [PF04956], Evalue: 9.6e-24, Aligned region: 1..101
Protein Sequence: 104 a.a.     [Download]
>gi|49474738|ref|YP_032780.1| conjugal transfer protein TrwL [Bartonella quintana str. Toulouse]
MKRLNNLQSKSNDKNIAIAAVITVFFMAHPAYAQAKGLDNAKKVLEDFKKQLDIIIPVAAALILLCLAIG
YAGRYIEKDTFIRWAIGVVIAGSATQIATMLFSG
 
Nucleotide Sequence: 315 bp     [Download]
>gi|49473688|ref|NC_005955.1|:1466119-1466433 Bartonella quintana str. Toulouse, complete genome
ATGAAACGATTAAATAACCTACAATCAAAAAGTAACGACAAAAACATTGCAATTGCTGCAGTTATAACCG
TGTTCTTTATGGCTCATCCTGCGTATGCTCAAGCGAAGGGTTTGGACAATGCTAAAAAGGTCTTAGAAGA
CTTCAAAAAACAATTGGATATAATTATTCCTGTTGCTGCTGCCCTTATCCTTTTATGCTTAGCAATTGGT
TATGCAGGACGCTATATCGAAAAAGATACATTCATACGGTGGGCAATCGGCGTTGTCATCGCTGGTTCAG
CAACTCAAATCGCCACTATGTTGTTCTCAGGTTAA
 Primer design

Protein ID: 49474739
T4SS name [ID]Trw [145]
Gene symboltrwL6
Locus tagBQ12540
StrainBartonella quintana str. Toulouse
Repliconchromosome [GenBank: NC_005955] [Browse all T4SS(s) in this replicon]
Location [Strand]1466566..1466883 [+]
Productconjugal transfer protein TrwL
Component typeTrwL
UniProt IDQ6FYJ4
KEGG IDbqu:BQ12540
PDB IDNA
Domain hit(s) vs Pfam TrbC [PF04956], Evalue: 6.6e-23, Aligned region: 1..102
Protein Sequence: 105 a.a.     [Download]
>gi|49474739|ref|YP_032781.1| conjugal transfer protein TrwL [Bartonella quintana str. Toulouse]
MKQLDNLQSKSNNKIIAIAVAITVLFMAYPAYVQAQALNNAKTVLQSLQSELTKKIIPIAAALMLLCLAI
GYAGRYIEKDTFIRWAVGVIIAGSATQIANMLLNQ
 
Nucleotide Sequence: 318 bp     [Download]
>gi|49473688|ref|NC_005955.1|:1466566-1466883 Bartonella quintana str. Toulouse, complete genome
ATGAAACAATTAGACAACCTACAATCAAAAAGTAATAATAAAATCATTGCAATTGCTGTAGCTATAACTG
TACTTTTTATGGCTTATCCTGCGTATGTTCAAGCACAAGCTCTAAATAACGCTAAAACTGTTCTACAAAG
CCTGCAGAGTGAACTTACTAAGAAAATTATACCTATCGCTGCTGCTCTTATGCTTTTATGCTTAGCAATT
GGTTATGCAGGACGCTATATCGAAAAAGATACATTCATACGGTGGGCAGTCGGCGTTATCATCGCTGGTT
CAGCAACCCAAATCGCTAATATGTTGCTCAATCAATAA
 Primer design

Protein ID: 49474740
T4SS name [ID]Trw [145]
Gene symboltrwL7
Locus tagBQ12550
StrainBartonella quintana str. Toulouse
Repliconchromosome [GenBank: NC_005955] [Browse all T4SS(s) in this replicon]
Location [Strand]1467013..1467330 [+]
Productconjugal transfer protein TrwL
Component typeTrwL
UniProt IDQ6FYJ3
KEGG IDbqu:BQ12550
PDB IDNA
Domain hit(s) vs Pfam TrbC [PF04956], Evalue: 5.6e-24, Aligned region: 1..102
Protein Sequence: 105 a.a.     [Download]
>gi|49474740|ref|YP_032782.1| conjugal transfer protein TrwL [Bartonella quintana str. Toulouse]
MKQLDNLQSKSNNKIIAIAAAITVLFMAYPAYAQAQTLDNAKGVLEKLSTELTTKIIPIAAALILLCLAI
GYAGRYIEKDTFIRWAVGVIIAGSATQIATMLFSG
 
Nucleotide Sequence: 318 bp     [Download]
>gi|49473688|ref|NC_005955.1|:1467013-1467330 Bartonella quintana str. Toulouse, complete genome
ATGAAACAATTAGACAACCTACAATCAAAAAGTAATAACAAAATCATTGCAATAGCTGCAGCTATAACTG
TGCTTTTTATGGCTTATCCTGCGTATGCTCAAGCACAAACTTTAGATAACGCTAAAGGTGTTCTAGAAAA
GCTGAGTACTGAACTTACTACGAAAATTATACCTATTGCTGCTGCCCTCATACTTTTATGCTTAGCAATT
GGTTATGCAGGACGCTATATCGAAAAAGATACATTCATACGGTGGGCAGTCGGCGTTATCATCGCTGGTT
CAGCAACCCAAATCGCCACTATGTTGTTCTCAGGTTAA
 Primer design

Protein ID: 49474741
T4SS name [ID]Trw [145]
Gene symboltrwL8
Locus tagBQ12560
StrainBartonella quintana str. Toulouse
Repliconchromosome [GenBank: NC_005955] [Browse all T4SS(s) in this replicon]
Location [Strand]1467478..1467792 [+]
Productconjugal transfer protein TrwL
Component typeTrwL
UniProt IDQ6FYJ2
KEGG IDbqu:BQ12560
PDB IDNA
Domain hit(s) vs Pfam TrbC [PF04956], Evalue: 3.8e-05, Aligned region: 8..96
Protein Sequence: 104 a.a.     [Download]
>gi|49474741|ref|YP_032783.1| conjugal transfer protein TrwL [Bartonella quintana str. Toulouse]
MKELNTFQAKTENNKISTIFATLIIFLAAQSAYAQTASKNIDVFIGVQYGLTLIIPIAAAIIFLFLLLIY
VFRIISRVTFVRWTFSVIIAGAAFYISSILFHIT
 
Nucleotide Sequence: 315 bp     [Download]
>gi|49473688|ref|NC_005955.1|:1467478-1467792 Bartonella quintana str. Toulouse, complete genome
ATGAAAGAGTTAAATACTTTTCAAGCAAAAACTGAAAATAACAAGATCAGTACTATTTTTGCAACTCTGA
TCATATTTTTAGCGGCCCAATCTGCATATGCCCAAACAGCAAGCAAAAACATAGATGTTTTTATAGGTGT
ACAATACGGATTAACTTTGATTATTCCCATTGCTGCTGCCATCATTTTTTTATTTCTCTTGCTTATTTAT
GTCTTTCGCATCATTTCAAGGGTTACATTCGTAAGATGGACATTTAGTGTTATTATTGCTGGAGCAGCAT
TTTATATTAGCAGTATATTGTTTCACATAACCTAA
 Primer design