SecReT4
Protein ID: 49474735
T4SS name [ID]Trw [145]
Gene symboltrwL2
Locus tagBQ12500
StrainBartonella quintana str. Toulouse
Repliconchromosome [GenBank: NC_005955] [Browse all T4SS(s) in this replicon]
Location [Strand]1464840..1465160 [+]
Productconjugal transfer protein TrwL
Component typeTrwL
UniProt IDQ6FYJ8
KEGG IDbqu:BQ12500
PDB IDNA
Domain hit(s) vs Pfam TrbC [PF04956], Evalue: 3.8e-23, Aligned region: 2..102
Protein Sequence: 106 a.a.     [Download]
>gi|49474735|ref|YP_032777.1| conjugal transfer protein TrwL [Bartonella quintana str. Toulouse]
MKRLNNLQSRSNDKSIAIAAATTVFFMAHPVYAQVSGLNNAKTVLEKLKTELTTTIIPIAAALILLCLAI
GYAGRYIEKDTFIRWAIGVIIAGSATQIATMLFKAT
 
Nucleotide Sequence: 321 bp     [Download]
>gi|49473688|ref|NC_005955.1|:1464840-1465160 Bartonella quintana str. Toulouse, complete genome
ATGAAGCGATTGAATAATCTACAATCAAGAAGTAACGACAAAAGCATCGCAATTGCTGCAGCTACGACCG
TGTTCTTTATGGCTCATCCTGTGTATGCGCAAGTGAGCGGTTTAAATAACGCTAAAACTGTTCTAGAAAA
GCTGAAGACTGAACTTACTACGACAATTATACCTATCGCTGCTGCTCTTATCCTTTTATGCTTAGCAATC
GGTTATGCAGGACGCTATATCGAAAAAGATACATTCATACGGTGGGCAATCGGTGTTATCATCGCTGGTT
CAGCAACTCAAATCGCCACAATGCTTTTTAAAGCTACATAG
 Primer design