SecReT4
Protein ID: 49474736
T4SS name [ID]Trw [145]
Gene symboltrwL3
Locus tagBQ12510
StrainBartonella quintana str. Toulouse
Repliconchromosome [GenBank: NC_005955] [Browse all T4SS(s) in this replicon]
Location [Strand]1465203..1465505 [+]
Productconjugal transfer protein TrwL
Component typeTrwL
UniProt IDQ6FYJ7
KEGG IDbqu:BQ12510
PDB IDNA
Domain hit(s) vs Pfam TrbC [PF04956], Evalue: 4.8e-20, Aligned region: 6..97
Protein Sequence: 100 a.a.     [Download]
>gi|49474736|ref|YP_032778.1| conjugal transfer protein TrwL [Bartonella quintana str. Toulouse]
MKRPNIKIAVYNKTIAAMTVFIMTHPVYAQAQTLDTAKSALSKFRTELNNIIPIAAALILLCLAIGYAGR
YIEKDTFIRWAVGVVIAGSATQIANMLFSS
 
Nucleotide Sequence: 303 bp     [Download]
>gi|49473688|ref|NC_005955.1|:1465203-1465505 Bartonella quintana str. Toulouse, complete genome
ATGAAACGACCAAACATTAAAATAGCAGTTTATAATAAAACCATCGCAGCTATGACTGTATTTATTATGA
CTCACCCTGTGTATGCCCAAGCACAAACTTTAGATACAGCAAAAAGTGCTTTAAGTAAGTTTCGGACTGA
ATTGAACAATATTATTCCTATTGCTGCTGCCCTTATCCTTTTATGCTTAGCAATCGGTTATGCAGGACGC
TATATCGAAAAAGATACATTCATACGGTGGGCAGTCGGCGTTGTTATCGCTGGTTCAGCAACTCAAATTG
CTAATATGTTGTTCTCAAGTTAA
 Primer design