SecReT4
Protein ID: 49474737
T4SS name [ID]Trw [145]
Gene symboltrwL4
Locus tagBQ12520
StrainBartonella quintana str. Toulouse
Repliconchromosome [GenBank: NC_005955] [Browse all T4SS(s) in this replicon]
Location [Strand]1465636..1465953 [+]
Productconjugal transfer protein TrwL
Component typeTrwL
UniProt IDQ6FYJ6
KEGG IDbqu:BQ12520
PDB IDNA
Domain hit(s) vs Pfam TrbC [PF04956], Evalue: 4.9e-23, Aligned region: 1..102
Protein Sequence: 105 a.a.     [Download]
>gi|49474737|ref|YP_032779.1| conjugal transfer protein TrwL [Bartonella quintana str. Toulouse]
MKQLDNLQSKSNNKIIAIAAAITVLFMAYPAYAQVQALSNAKNVLESLQSELTTKIIPIAAALILLCLAI
GYAGRYIEKDTFIRWAVGVIIAGSATQIATMLFKP
 
Nucleotide Sequence: 318 bp     [Download]
>gi|49473688|ref|NC_005955.1|:1465636-1465953 Bartonella quintana str. Toulouse, complete genome
ATGAAACAATTAGACAACCTACAATCAAAAAGTAATAACAAAATCATTGCAATTGCCGCAGCTATAACTG
TACTTTTTATGGCTTATCCTGCGTATGCTCAAGTACAAGCTTTAAGTAACGCTAAAAATGTTCTAGAAAG
CCTGCAGAGTGAACTTACTACGAAAATTATACCTATTGCTGCTGCCCTCATACTTTTATGCTTAGCAATT
GGTTATGCAGGACGCTATATCGAAAAAGATACATTCATACGGTGGGCAGTCGGCGTTATCATCGCTGGTT
CAGCAACCCAAATCGCCACAATGCTTTTTAAACCTTGA
 Primer design