SecReT4
Protein ID: 49474739
T4SS name [ID]Trw [145]
Gene symboltrwL6
Locus tagBQ12540
StrainBartonella quintana str. Toulouse
Repliconchromosome [GenBank: NC_005955] [Browse all T4SS(s) in this replicon]
Location [Strand]1466566..1466883 [+]
Productconjugal transfer protein TrwL
Component typeTrwL
UniProt IDQ6FYJ4
KEGG IDbqu:BQ12540
PDB IDNA
Domain hit(s) vs Pfam TrbC [PF04956], Evalue: 6.6e-23, Aligned region: 1..102
Protein Sequence: 105 a.a.     [Download]
>gi|49474739|ref|YP_032781.1| conjugal transfer protein TrwL [Bartonella quintana str. Toulouse]
MKQLDNLQSKSNNKIIAIAVAITVLFMAYPAYVQAQALNNAKTVLQSLQSELTKKIIPIAAALMLLCLAI
GYAGRYIEKDTFIRWAVGVIIAGSATQIANMLLNQ
 
Nucleotide Sequence: 318 bp     [Download]
>gi|49473688|ref|NC_005955.1|:1466566-1466883 Bartonella quintana str. Toulouse, complete genome
ATGAAACAATTAGACAACCTACAATCAAAAAGTAATAATAAAATCATTGCAATTGCTGTAGCTATAACTG
TACTTTTTATGGCTTATCCTGCGTATGTTCAAGCACAAGCTCTAAATAACGCTAAAACTGTTCTACAAAG
CCTGCAGAGTGAACTTACTAAGAAAATTATACCTATCGCTGCTGCTCTTATGCTTTTATGCTTAGCAATT
GGTTATGCAGGACGCTATATCGAAAAAGATACATTCATACGGTGGGCAGTCGGCGTTATCATCGCTGGTT
CAGCAACCCAAATCGCTAATATGTTGCTCAATCAATAA
 Primer design