SecReT4
Protein ID: 49474741
T4SS name [ID]Trw [145]
Gene symboltrwL8
Locus tagBQ12560
StrainBartonella quintana str. Toulouse
Repliconchromosome [GenBank: NC_005955] [Browse all T4SS(s) in this replicon]
Location [Strand]1467478..1467792 [+]
Productconjugal transfer protein TrwL
Component typeTrwL
UniProt IDQ6FYJ2
KEGG IDbqu:BQ12560
PDB IDNA
Domain hit(s) vs Pfam TrbC [PF04956], Evalue: 3.8e-05, Aligned region: 8..96
Protein Sequence: 104 a.a.     [Download]
>gi|49474741|ref|YP_032783.1| conjugal transfer protein TrwL [Bartonella quintana str. Toulouse]
MKELNTFQAKTENNKISTIFATLIIFLAAQSAYAQTASKNIDVFIGVQYGLTLIIPIAAAIIFLFLLLIY
VFRIISRVTFVRWTFSVIIAGAAFYISSILFHIT
 
Nucleotide Sequence: 315 bp     [Download]
>gi|49473688|ref|NC_005955.1|:1467478-1467792 Bartonella quintana str. Toulouse, complete genome
ATGAAAGAGTTAAATACTTTTCAAGCAAAAACTGAAAATAACAAGATCAGTACTATTTTTGCAACTCTGA
TCATATTTTTAGCGGCCCAATCTGCATATGCCCAAACAGCAAGCAAAAACATAGATGTTTTTATAGGTGT
ACAATACGGATTAACTTTGATTATTCCCATTGCTGCTGCCATCATTTTTTTATTTCTCTTGCTTATTTAT
GTCTTTCGCATCATTTCAAGGGTTACATTCGTAAGATGGACATTTAGTGTTATTATTGCTGGAGCAGCAT
TTTATATTAGCAGTATATTGTTTCACATAACCTAA
 Primer design