SecReT4
Protein ID: 49474742
T4SS name [ID]Trw [145]
Gene symboltrwM
Locus tagBQ12570
StrainBartonella quintana str. Toulouse
Repliconchromosome [GenBank: NC_005955] [Browse all T4SS(s) in this replicon]
Location [Strand]1467809..1468117 [+]
ProducttrwM protein
Component typeTrwM
UniProt IDQ6FYJ1
KEGG IDbqu:BQ12570
PDB IDNA
Domain hit(s) vs Pfam VirB3 [PF05101], Evalue: 2.8e-24, Aligned region: 1..91
Protein Sequence: 102 a.a.     [Download]
>gi|49474742|ref|YP_032784.1| trwM protein [Bartonella quintana str. Toulouse]
MKSQKHEAFPLFKGATRVPTIWGVPMMPLIVMVMGVAVMSMTINIFLWLIAPPLWFVMAQITKNDDKAFH
IWWLWIDTKFRNRNKSFWGASSYSPSNYQKRR
 
Nucleotide Sequence: 309 bp     [Download]
>gi|49473688|ref|NC_005955.1|:1467809-1468117 Bartonella quintana str. Toulouse, complete genome
ATGAAATCACAAAAGCACGAAGCATTTCCCTTATTTAAGGGAGCGACTCGCGTTCCAACAATTTGGGGTG
TCCCAATGATGCCGCTTATAGTTATGGTTATGGGCGTAGCCGTTATGTCCATGACAATAAACATCTTTTT
ATGGCTTATCGCACCGCCATTGTGGTTCGTCATGGCACAAATTACTAAGAATGATGACAAAGCATTCCAT
ATCTGGTGGTTGTGGATCGACACCAAATTTCGCAACCGTAACAAGAGCTTTTGGGGCGCATCAAGTTACA
GTCCCTCTAATTACCAGAAAAGGAGATAA
 Primer design