SecReT4
Protein ID: 49474743
T4SS name [ID]Trw [145]
Gene symboltrwK
Locus tagBQ12580
StrainBartonella quintana str. Toulouse
Repliconchromosome [GenBank: NC_005955] [Browse all T4SS(s) in this replicon]
Location [Strand]1468120..1470591 [+]
ProducttrwK protein
Component typeTrwK
UniProt IDQ6FYJ0
KEGG IDbqu:BQ12580
PDB IDNA
Domain hit(s) vs Pfam CagE_TrbE_VirB [PF03135], Evalue: 3.2e-62, Aligned region: 177..382
AAA_10 [PF12846], Evalue: 1.4e-40, Aligned region: 445..731
Protein Sequence: 823 a.a.     [Download]
>gi|49474743|ref|YP_032785.1| trwK protein [Bartonella quintana str. Toulouse]
MTAVESIKRLASETPVSLFIPYSHHVTDTIISTKNAEYLSVWKIDGRSHQSASEEDIFRWTKELNNTLRG
IASANLSLWTHIVRRRVYEYPDSTFDKIFCYQLDEKYRQSFVGYNLMVNDLYLTIVFQPVTDKVMSFFSQ
HERETLDQKKMRQESCIKALNDINRTLSQSFKCYGAELLGAYEKNGHAYSSALEFLAMLVNGEYQPMPIC
HDRFADYMSINRPFFSKWGALGELRTTTGMRRFGMMEIKEYDTTTKPGQLNVLLESDFEFVLTQSFSVLS
RHAAKDYLQRHQRNLIDARDVATSQIEQIDEALNQLVSGHFVMGEHHCTLTIYGDTIQQVRDYMAKANAD
MLDVGVLPKPVDLAIEAGYWAQLPGNWKWRPRPAPITSLNFLSFSSFHNFMSGKPTGNPWGPAVTILKTI
SKTPLYFNFHASKLEEDATNKRLLGNTAIIGQSGSGKTVLLGFLLAQAQKFKPTTVVFDKDRGMEIAIRA
MGGRYLTFKPGRPSSFNPFQLPPTQDNLTFLKQFVKKLAEAGGEITHRDEEEINQAVISIMSSNIDRSLR
RLSFLLQFLPNPRSSHYNAHPSVHARLAKWCQNGDYGWLFDNPQDALDLSTHQIYGFDITEFLDNPETRT
PVIMYLFYRTEGMISGQRFMYIFDEFWKSLQDPYFEDLAKNKQKTIRKQNGIFVFATQEPSDALESNIAK
TLIQQCATYIFLANPKASYEDYTEGFKLTDAEFELVKGLGEFSRQFLIKQGDQSALAELNLGKFNVTTDG
KTIERDFSDELLVLSGTPDNAELVETLIAEVGDDPAVWLPVFLQHIKTERRVI
 
Nucleotide Sequence: 2472 bp     [Download]
>gi|49473688|ref|NC_005955.1|:1468120-1470591 Bartonella quintana str. Toulouse, complete genome
ATGACGGCTGTTGAAAGCATAAAACGGCTTGCATCAGAAACACCAGTAAGTTTGTTTATACCCTATTCAC
ACCACGTTACAGATACGATTATCTCTACCAAAAATGCGGAGTATTTGTCGGTCTGGAAAATTGATGGACG
CTCACATCAAAGCGCTTCAGAAGAGGATATTTTTCGGTGGACTAAAGAGCTAAACAATACCCTGCGTGGT
ATTGCATCGGCTAATTTATCACTGTGGACACATATCGTACGTCGACGTGTTTATGAATATCCTGATTCAA
CATTTGATAAAATATTTTGCTATCAGCTTGATGAAAAGTACCGACAAAGTTTTGTTGGTTATAATCTAAT
GGTCAATGATCTGTATTTGACCATTGTGTTCCAACCAGTCACTGATAAGGTTATGTCGTTTTTTTCCCAG
CATGAACGTGAAACGCTTGATCAAAAAAAGATGCGGCAAGAATCATGTATTAAAGCTCTCAATGATATCA
ACCGTACCTTAAGTCAATCGTTTAAATGTTATGGTGCCGAACTTCTTGGTGCATATGAAAAAAATGGTCA
CGCTTATTCTTCTGCCCTTGAATTTCTCGCAATGCTTGTCAATGGTGAATACCAGCCTATGCCAATCTGC
CATGACCGTTTTGCTGACTATATGTCTATCAATCGGCCTTTCTTCTCAAAATGGGGAGCACTGGGTGAAC
TGCGCACAACCACTGGAATGCGCCGATTTGGAATGATGGAAATTAAGGAATATGACACAACAACCAAACC
GGGCCAGTTAAATGTCTTACTGGAAAGTGATTTCGAATTTGTGTTAACACAGAGCTTTTCTGTACTCTCG
CGCCATGCAGCCAAGGATTATTTGCAGCGGCATCAACGGAATCTTATCGACGCTCGCGATGTAGCAACAA
GTCAAATTGAGCAAATTGACGAAGCACTTAATCAACTTGTAAGTGGGCATTTTGTCATGGGTGAGCACCA
TTGCACATTGACCATCTACGGCGATACAATTCAACAAGTTCGCGACTATATGGCAAAAGCGAATGCGGAT
ATGCTAGACGTTGGCGTGTTACCAAAACCTGTAGATTTGGCCATAGAAGCTGGCTATTGGGCACAACTTC
CCGGAAATTGGAAATGGCGACCACGTCCCGCACCAATTACGTCATTGAACTTTTTATCATTCTCATCTTT
TCATAACTTTATGTCAGGCAAACCAACGGGGAATCCATGGGGGCCGGCAGTTACAATTCTTAAAACAATA
AGTAAAACACCGCTTTATTTCAATTTTCATGCCTCTAAACTCGAAGAAGATGCGACAAATAAGCGGTTAC
TTGGTAATACTGCAATCATTGGACAGTCTGGTTCTGGTAAAACCGTCCTTCTTGGATTTTTGTTAGCGCA
AGCGCAAAAATTCAAACCGACAACTGTCGTTTTTGATAAAGATCGTGGCATGGAAATTGCCATTCGTGCT
ATGGGGGGACGGTATCTAACATTCAAACCTGGTAGGCCAAGTAGTTTTAATCCGTTCCAACTTCCACCGA
CACAAGACAACCTAACTTTTCTTAAACAATTTGTTAAAAAATTGGCAGAAGCTGGTGGCGAAATCACACA
CCGCGACGAAGAGGAAATTAATCAAGCTGTCATATCTATTATGAGCAGTAACATTGACCGATCGCTCCGT
CGTTTGTCTTTTCTGCTGCAATTCTTACCCAATCCGCGTTCAAGTCATTATAATGCACACCCATCTGTTC
ACGCTCGCTTGGCAAAATGGTGCCAAAATGGTGATTATGGGTGGCTCTTTGATAATCCTCAGGATGCACT
TGATCTCTCAACGCATCAAATTTACGGCTTTGATATTACAGAATTCTTAGATAATCCAGAGACTCGTACT
CCAGTGATAATGTACTTGTTCTATCGTACAGAAGGAATGATCAGTGGGCAACGGTTTATGTATATCTTTG
ACGAGTTTTGGAAATCTTTACAGGATCCGTATTTTGAAGATTTAGCAAAGAACAAGCAAAAAACTATTCG
TAAACAAAACGGTATTTTTGTTTTTGCTACGCAAGAGCCTAGTGATGCGCTGGAAAGCAATATTGCTAAG
ACGCTCATTCAACAATGTGCAACCTACATTTTTCTAGCCAATCCCAAAGCGAGTTATGAAGATTATACTG
AAGGCTTCAAACTAACAGATGCTGAATTTGAACTGGTCAAAGGACTTGGTGAATTTAGTCGTCAGTTCCT
CATCAAGCAAGGTGATCAGTCTGCGCTTGCCGAGCTTAATCTCGGCAAATTTAATGTCACAACTGATGGA
AAAACTATCGAACGTGACTTTAGTGACGAACTCTTAGTATTATCCGGTACGCCTGACAATGCAGAGTTGG
TCGAAACACTTATCGCTGAAGTCGGAGACGATCCAGCGGTATGGTTGCCAGTTTTTTTACAACATATAAA
AACTGAGAGGAGAGTAATATGA
 Primer design