SecReT4
Protein ID: 49474744
T4SS name [ID]Trw [145]
Gene symboltrwJ1
Locus tagBQ12590
StrainBartonella quintana str. Toulouse
Repliconchromosome [GenBank: NC_005955] [Browse all T4SS(s) in this replicon]
Location [Strand]1470588..1471340 [+]
Productconjugal transfer protein TrwJ
Component typeTrwJ
UniProt IDQ6FYI9
KEGG IDbqu:BQ12590
PDB IDNA
Domain hit(s) vs Pfam T4SS [PF07996], Evalue: 8e-48, Aligned region: 46..230
Protein Sequence: 250 a.a.     [Download]
>gi|49474744|ref|YP_032786.1| conjugal transfer protein TrwJ [Bartonella quintana str. Toulouse]
MKIKKIIIPLAIAVVLGIPNSAMAFFWGAGAADLSRTVPDIFGSSSQQTSKPSIKNNALLLALIRQHLEV
NKQQLEQAKKMQQSIMGNKASGTSQEKYTSFFFKDPQLVYNSKEKHADISASFEKIRKEEEEVSTSLAGA
RESIEKRSEYAALVDKAISLQAFQQTENRSKKILELLNEIDKTKDLKSIADLQAQIKGKLAMIQNEATKL
QMVAYLRNTEQELISQQKQKRNLKILNSKSREMPTIRFIR
 
Nucleotide Sequence: 753 bp     [Download]
>gi|49473688|ref|NC_005955.1|:1470588-1471340 Bartonella quintana str. Toulouse, complete genome
ATGAAGATAAAAAAGATAATAATTCCATTAGCGATAGCCGTAGTTTTAGGGATCCCAAACTCAGCAATGG
CTTTTTTTTGGGGAGCTGGGGCAGCGGATTTAAGCCGAACAGTACCAGATATATTTGGTAGCTCCTCCCA
ACAGACAAGTAAACCTTCAATAAAAAACAATGCGTTACTTTTAGCTTTAATAAGACAACATCTCGAGGTA
AACAAGCAGCAACTGGAGCAAGCTAAAAAAATGCAACAGTCCATAATGGGAAATAAAGCGTCCGGTACTT
CACAAGAAAAATATACCAGCTTTTTTTTCAAAGATCCACAATTGGTCTATAATAGTAAGGAAAAACATGC
AGATATATCTGCATCATTTGAGAAGATCCGGAAAGAAGAGGAAGAAGTTTCTACCTCTCTTGCTGGAGCG
CGTGAATCTATAGAAAAACGTAGCGAGTATGCAGCGTTGGTTGATAAAGCTATAAGCTTGCAAGCTTTTC
AGCAAACAGAGAATCGCTCTAAAAAAATTTTAGAGTTGTTAAACGAAATCGACAAAACAAAGGATCTGAA
AAGCATTGCTGACTTACAGGCTCAGATTAAGGGCAAACTAGCCATGATCCAAAATGAAGCAACAAAATTG
CAAATGGTTGCATATTTACGCAATACGGAACAGGAACTTATAAGCCAACAAAAACAAAAACGCAATCTAA
AGATTCTTAACAGTAAAAGCAGAGAAATGCCAACTATACGTTTTATCCGATGA
 Primer design