SecReT4
Protein ID: 49474745
T4SS name [ID]Trw [145]
Gene symboltrwI1
Locus tagBQ12600
StrainBartonella quintana str. Toulouse
Repliconchromosome [GenBank: NC_005955] [Browse all T4SS(s) in this replicon]
Location [Strand]1471585..1472469 [+]
ProducttrwI1 protein
Component typeTrwI
UniProt IDQ6FYI5
KEGG IDbqu:BQ12600, bqu:BQ12630
PDB IDNA
Domain hit(s) vs Pfam TrbL [PF04610], Evalue: 1.4e-51, Aligned region: 40..267
Protein Sequence: 294 a.a.     [Download]
>gi|49474745|ref|YP_032787.1| trwI1 protein [Bartonella quintana str. Toulouse]
MAFKMFTQLFTKIDQVIATYVTDISSKIIATMTPFVSISLTIAFIVYGWLIMRGAIDMPVSGFLSRCLRI
SIITSIALTTGLYQPDLTNLIIKMPDELVNALISNPPKNSQFTNLIDRVAEKGFDRASEAFEESAFLNAD
GLLFGLFGILILLATSFLVAIGGAFILLAKIALILLAGLGPFFIIALLWQPTYRFFEQWIGQVLSYTILF
VLLATMFSLMMDIFANYMGDLKFDGQQNIGYTLGGALILSITSIMLLLKLSSIASALAKGITFGHLWRHG
AGVGNASQKSRIAK
 
Nucleotide Sequence: 885 bp     [Download]
>gi|49473688|ref|NC_005955.1|:1471585-1472469 Bartonella quintana str. Toulouse, complete genome
ATGGCTTTCAAAATGTTTACGCAACTGTTCACTAAAATTGATCAGGTAATAGCAACATATGTCACGGATA
TTTCATCAAAGATTATTGCTACAATGACCCCCTTCGTATCCATCAGTCTTACCATCGCCTTCATCGTCTA
TGGATGGCTCATTATGCGTGGGGCAATAGATATGCCAGTCTCTGGATTCTTGAGCCGTTGTCTGCGAATC
AGCATTATTACTTCAATTGCATTAACTACAGGGCTATATCAGCCAGATCTGACAAATTTGATAATAAAAA
TGCCTGATGAGCTGGTAAACGCGCTGATAAGCAATCCACCAAAAAATAGTCAATTCACTAACTTGATTGA
CAGAGTGGCTGAAAAAGGTTTCGACCGTGCAAGCGAAGCTTTCGAGGAATCCGCTTTCTTGAATGCCGAT
GGGTTGCTTTTCGGTCTCTTCGGCATCCTCATCTTGCTTGCAACAAGCTTCCTCGTAGCAATCGGTGGTG
CATTCATTCTGTTAGCAAAAATCGCACTTATACTTCTCGCCGGACTCGGACCTTTCTTCATCATTGCATT
ACTCTGGCAACCAACCTACCGCTTTTTCGAGCAATGGATAGGCCAAGTCTTGAGCTACACAATTCTCTTT
GTGCTTCTCGCCACTATGTTTAGTCTAATGATGGATATTTTTGCAAATTACATGGGAGATCTGAAATTTG
ATGGACAGCAAAATATCGGTTACACACTTGGTGGTGCACTCATCTTGTCCATTACCTCCATTATGCTGTT
GCTCAAACTATCCAGCATTGCCAGTGCTTTGGCAAAAGGCATTACCTTTGGACATCTCTGGAGACACGGT
GCAGGGGTAGGCAATGCTTCTCAAAAAAGTCGCATAGCCAAATGA
 Primer design