SecReT4
Protein ID: 49474746
T4SS name [ID]Trw [145]
Gene symboltrwH1
Locus tagBQ12610
StrainBartonella quintana str. Toulouse
Repliconchromosome [GenBank: NC_005955] [Browse all T4SS(s) in this replicon]
Location [Strand]1472635..1472778 [+]
Producthypothetical protein
Component typeTrwH
UniProt IDQ6FYI4
KEGG IDbqu:BQ12610, bqu:BQ12640
PDB IDNA
Domain hit(s) vs Pfam NA
Protein Sequence: 47 a.a.     [Download]
>gi|49474746|ref|YP_032788.1| hypothetical protein BQ12610 [Bartonella quintana str. Toulouse]
MRSIIFTILIASLLSACTLAPKPKQPSNWNRVPVNKVVPAEIQRGVI
 
Nucleotide Sequence: 144 bp     [Download]
>gi|49473688|ref|NC_005955.1|:1472635-1472778 Bartonella quintana str. Toulouse, complete genome
ATGAGATCAATCATTTTTACAATTTTGATTGCGAGTCTTTTATCGGCTTGCACATTGGCTCCAAAACCAA
AACAACCCAGTAATTGGAATCGAGTGCCTGTTAATAAAGTGGTCCCTGCCGAAATTCAGCGAGGAGTGAT
ATGA
 Primer design