SecReT4
Protein ID: 49474747
T4SS name [ID]Trw [145]
Gene symboltrwJ2
Locus tagBQ12620
StrainBartonella quintana str. Toulouse
Repliconchromosome [GenBank: NC_005955] [Browse all T4SS(s) in this replicon]
Location [Strand]1472944..1473735 [+]
Productconjugal transfer protein TrwJ
Component typeTrwJ
UniProt IDQ6FYI6
KEGG IDbqu:BQ12620
PDB IDNA
Domain hit(s) vs Pfam T4SS [PF07996], Evalue: 2.6e-48, Aligned region: 28..240
Protein Sequence: 263 a.a.     [Download]
>gi|49474747|ref|YP_032789.1| conjugal transfer protein TrwJ [Bartonella quintana str. Toulouse]
MKKLIIIALVSVVLGMPNSILAYSSRGHVNPQTSLYQLQRSLQQSKAREESQKNKEQLKFDGNALLEALK
KQLEINKQQLEEAKRLHESITNNQRTINIQQDSDDFFLKNPQFIYKRDKESEINQVAVFIKDIRDKENYL
HNVSVSTREARDSINERIKYAALVDKAVSLRVFEETKNRFSQIEKMLKDIDTMADLKSIANLQAQIKGKL
AMIQNEATKLQMVAHLRNAEQELISQLKRKRSATIFKSENTKMPDIQYVKAIQ
 
Nucleotide Sequence: 792 bp     [Download]
>gi|49473688|ref|NC_005955.1|:1472944-1473735 Bartonella quintana str. Toulouse, complete genome
ATGAAAAAGCTGATTATTATAGCATTAGTAAGTGTAGTTCTTGGAATGCCAAACTCAATACTAGCATACT
CGAGTCGAGGTCATGTTAACCCTCAAACAAGTTTGTATCAGTTACAAAGAAGCTTACAACAAAGCAAGGC
TAGGGAAGAATCGCAAAAAAATAAAGAGCAGTTAAAATTTGATGGTAATGCTTTGCTAGAAGCATTAAAG
AAACAGCTAGAGATCAACAAACAGCAACTCGAGGAAGCAAAAAGACTGCATGAGTCTATAACAAACAATC
AAAGAACCATCAACATACAACAAGATAGTGATGATTTTTTTCTTAAAAACCCACAATTCATCTACAAACG
CGATAAAGAATCAGAGATAAATCAGGTTGCAGTCTTCATCAAAGATATTAGAGATAAAGAAAATTATCTT
CACAATGTCTCTGTCTCTACTCGTGAAGCACGCGACTCTATCAATGAACGTATCAAATATGCAGCGTTGG
TTGATAAAGCTGTAAGTTTGCGAGTTTTTGAAGAAACAAAAAATCGTTTTAGCCAAATCGAAAAAATGTT
AAAAGATATCGACACAATGGCCGATCTGAAAAGCATTGCTAACTTACAGGCTCAGATTAAGGGCAAACTA
GCCATGATCCAAAATGAAGCAACAAAATTGCAAATGGTTGCGCATTTGCGTAACGCTGAACAGGAACTCA
TCAGCCAGCTAAAACGTAAACGCAGCGCCACAATTTTTAAAAGTGAAAACACAAAAATGCCAGATATACA
GTATGTAAAGGCCATCCAGTGA
 Primer design