SecReT4
Protein ID: 49474750
T4SS name [ID]Trw [145]
Gene symboltrwG
Locus tagBQ12650
StrainBartonella quintana str. Toulouse
Repliconchromosome [GenBank: NC_005955] [Browse all T4SS(s) in this replicon]
Location [Strand]1475170..1475868 [+]
ProducttrwG protein
Component typeTrwG
UniProt IDQ6FYI3
KEGG IDbqu:BQ12650
PDB IDNA
Domain hit(s) vs Pfam VirB8 [PF04335], Evalue: 2e-56, Aligned region: 22..227
Protein Sequence: 232 a.a.     [Download]
>gi|49474750|ref|YP_032792.1| trwG protein [Bartonella quintana str. Toulouse]
MKKKEVKPVKAERLNSYYEESRGLERELIGEFIRSRKTAWRVACVVGIFGLFGMMCGVVGFSQPAPTPLV
LRVDNTTGAVDVISMMREHETSYGEVVDRYWLNQYVLNRESYDYDTIQLNYDTAALLSSPTVQQEFYKIY
EGENARDQVLSNKARITVKVRSIQPNGRGQATVRFTTQQHDSKGTVGPKQHQIATIGYTYVGAPMKSSDR
LLNPLGFQITSYRADPEILLND
 
Nucleotide Sequence: 699 bp     [Download]
>gi|49473688|ref|NC_005955.1|:1475170-1475868 Bartonella quintana str. Toulouse, complete genome
ATGAAAAAAAAAGAAGTGAAACCAGTAAAAGCCGAACGACTGAACAGTTATTATGAAGAAAGCCGAGGTC
TAGAACGTGAACTCATCGGCGAGTTTATAAGATCACGTAAAACAGCGTGGCGTGTAGCATGCGTTGTTGG
CATTTTTGGGTTGTTTGGCATGATGTGTGGGGTGGTCGGCTTTTCCCAACCAGCTCCCACGCCCTTGGTG
CTGCGCGTTGATAACACAACTGGCGCGGTCGATGTTATTTCTATGATGCGTGAACATGAAACTAGCTATG
GCGAAGTCGTGGACAGGTACTGGCTCAATCAATATGTGCTTAACCGTGAAAGTTATGATTACGACACCAT
TCAGCTGAACTATGATACTGCAGCACTTTTAAGTTCTCCAACTGTTCAACAGGAGTTTTACAAAATCTAT
GAGGGTGAAAATGCCCGCGATCAAGTGCTTTCCAACAAAGCGCGCATTACAGTTAAAGTACGCTCGATTC
AGCCAAATGGGCGAGGTCAAGCGACTGTGCGTTTTACAACACAACAACACGACAGTAAAGGCACAGTTGG
GCCAAAGCAACATCAAATCGCAACAATTGGCTACACCTATGTTGGTGCGCCAATGAAATCATCTGATCGA
TTGCTTAATCCTCTTGGTTTTCAAATTACAAGTTACCGCGCTGACCCGGAAATACTTTTGAATGATTAA
 Primer design