SecReT4
Protein ID: 49474751
T4SS name [ID]Trw [145]
Gene symboltrwF
Locus tagBQ12660
StrainBartonella quintana str. Toulouse
Repliconchromosome [GenBank: NC_005955] [Browse all T4SS(s) in this replicon]
Location [Strand]1475882..1476682 [+]
ProducttrwF protein
Component typeTrwF
UniProt IDQ6FYI2
KEGG IDbqu:BQ12660
PDB IDNA
Domain hit(s) vs Pfam CagX [PF03524], Evalue: 1.3e-59, Aligned region: 31..240
Protein Sequence: 266 a.a.     [Download]
>gi|49474751|ref|YP_032793.1| trwF protein [Bartonella quintana str. Toulouse]
MKKLVFIALLFSSFYTIPVQALKTPSSSQYDHRIRYVTYNVADVVQIETVLGVATHIILEEGEQYITHAF
GDSEAYAFAHKGRHIFIKPKAELANTNLIVVTDKRSYKFRLQFRSDRAGATYELAFHYLDANNKKLEENN
QRLAIERGFHQAVNGYNLSYTMSGNQDIAPINAWDNGRITYFKFPANMDMPSIYIVDAEGNESLIPRTVV
GSSNDIIAVHKVNPKWLIRLGKRALAVFNEAYDPNGIPNTTGTVSSVVHRINKGGK
 
Nucleotide Sequence: 801 bp     [Download]
>gi|49473688|ref|NC_005955.1|:1475882-1476682 Bartonella quintana str. Toulouse, complete genome
ATGAAAAAACTTGTGTTTATCGCACTCCTGTTTTCCTCTTTTTATACGATACCCGTGCAAGCGCTCAAAA
CCCCATCCAGTTCCCAATATGACCATCGCATTCGCTATGTAACATATAATGTCGCTGATGTGGTTCAGAT
TGAAACCGTTCTCGGTGTAGCAACACATATCATTCTTGAAGAAGGCGAGCAGTATATCACCCACGCCTTT
GGCGATTCTGAAGCTTATGCTTTTGCGCATAAAGGGCGTCACATTTTTATTAAACCCAAAGCAGAACTCG
CCAATACGAACCTTATCGTTGTTACCGACAAGCGTAGTTATAAATTCCGGCTACAGTTTCGAAGTGATCG
TGCTGGAGCTACCTATGAATTAGCTTTCCATTATCTCGATGCAAATAATAAAAAGTTAGAGGAAAACAAC
CAACGCCTTGCTATTGAACGTGGTTTTCATCAAGCCGTGAACGGTTATAACCTTAGTTACACCATGAGCG
GCAACCAAGATATTGCTCCTATAAATGCTTGGGACAATGGACGTATTACCTATTTCAAGTTTCCCGCCAA
CATGGATATGCCATCAATTTACATTGTGGATGCTGAAGGCAATGAAAGCTTGATACCGCGTACTGTTGTA
GGCAGTTCCAATGATATTATCGCTGTTCATAAAGTCAACCCTAAGTGGCTCATACGACTTGGCAAACGCG
CTTTAGCTGTTTTCAATGAAGCCTATGACCCCAATGGTATACCAAACACAACTGGAACGGTATCCTCGGT
GGTTCATCGCATCAATAAAGGAGGTAAATGA
 Primer design