SecReT4
Protein ID: 49474752
T4SS name [ID]Trw [145]
Gene symboltrwE
Locus tagBQ12670
StrainBartonella quintana str. Toulouse
Repliconchromosome [GenBank: NC_005955] [Browse all T4SS(s) in this replicon]
Location [Strand]1476682..1477854 [+]
ProducttrwE protein
Component typeTrwE
UniProt IDQ6FYI1
KEGG IDbqu:BQ12670
PDB IDNA
Domain hit(s) vs Pfam TrbI [PF03743], Evalue: 1.4e-62, Aligned region: 199..381
Protein Sequence: 390 a.a.     [Download]
>gi|49474752|ref|YP_032794.1| trwE protein [Bartonella quintana str. Toulouse]
MFDNKKGDEINTGAEQDYTEHKHIEGAYGSSELDSERRPIVPGARTLLIVGLIVIVALPIALSWKALKMR
NAIDVEEEKPQQTVEQIIPRYTPRITEEPKILEEPEKPVQAEELTQSIPPALAQLLQTMPPHLIQDAEEL
ARKRMLSSGLNNGSSSESSAENSKKNTFDNGNSGVLFDKLQPVRLGQSHAAQLRNRDLLITQGTQIDCTL
ETKIVTSQPGMTTCHLTRDVYSTSGRVVLLDRGSKVVGFYQSGIQQGQTRVFVQWSRIETPSGVIVNLDS
PGTGPLGESGIDGWIDTHFWQRFGGAIMMSIIGDLGGWVKNKIGQGNKESKEGKEKSLSQNTQGPESVVN
EVLHNSINIPPTLYKNQGERVSIFVARDLDFSDVYSLIIR
 
Nucleotide Sequence: 1173 bp     [Download]
>gi|49473688|ref|NC_005955.1|:1476682-1477854 Bartonella quintana str. Toulouse, complete genome
ATGTTCGACAATAAGAAAGGAGATGAGATCAATACAGGTGCAGAACAAGACTACACTGAGCATAAACATA
TTGAAGGTGCGTATGGTAGCTCCGAATTAGACTCGGAACGCCGTCCAATAGTTCCCGGTGCACGGACATT
GTTAATAGTAGGGCTCATTGTCATAGTAGCGTTGCCGATTGCTCTGTCTTGGAAGGCTTTAAAAATGCGC
AATGCCATAGACGTTGAAGAAGAAAAGCCTCAACAGACAGTAGAGCAAATTATACCTCGCTACACCCCTC
GAATCACAGAGGAACCGAAAATCTTAGAAGAACCAGAAAAACCAGTACAGGCAGAAGAACTAACGCAGTC
TATTCCACCAGCCTTAGCACAACTTCTTCAAACAATGCCACCACATTTGATCCAGGATGCTGAAGAATTG
GCACGCAAACGTATGTTAAGTTCTGGTCTTAACAATGGTAGCAGTAGCGAAAGCTCTGCAGAAAATTCAA
AAAAGAATACATTTGACAATGGAAATAGTGGTGTATTATTCGATAAGCTCCAGCCTGTACGATTAGGTCA
ATCACACGCGGCCCAACTGCGTAACCGTGATCTCTTGATTACGCAGGGAACGCAAATAGATTGTACGCTG
GAAACAAAAATCGTCACATCACAACCGGGAATGACAACATGTCATTTAACACGTGATGTCTATTCTACGA
GCGGTCGTGTTGTTTTGCTCGATCGTGGTTCCAAAGTCGTCGGTTTCTACCAAAGTGGCATACAACAAGG
ACAAACGCGCGTTTTCGTGCAATGGTCGCGTATTGAAACGCCGTCTGGTGTTATTGTCAATCTTGACTCA
CCTGGTACTGGCCCTCTTGGGGAATCTGGGATCGATGGTTGGATTGATACACATTTCTGGCAAAGATTTG
GCGGTGCAATCATGATGAGTATAATCGGTGATTTGGGAGGATGGGTGAAAAATAAAATTGGTCAAGGAAA
TAAAGAAAGCAAAGAAGGCAAGGAAAAATCACTATCTCAAAATACACAGGGTCCTGAATCAGTGGTTAAC
GAAGTTCTTCACAATTCAATCAACATTCCACCAACACTTTACAAAAACCAAGGCGAGCGGGTGAGTATTT
TTGTTGCTCGCGATCTGGATTTCAGCGATGTCTACAGCCTCATTATACGCTAA
 Primer design