SecReT4
Protein ID: 49474753
T4SS name [ID]Trw [145]
Gene symboltrwD
Locus tagBQ12680
StrainBartonella quintana str. Toulouse
Repliconchromosome [GenBank: NC_005955] [Browse all T4SS(s) in this replicon]
Location [Strand]1477829..1478890 [+]
ProducttrwD protein
Component typeTrwD
UniProt IDQ6FYI0
KEGG IDbqu:BQ12680
PDB IDNA
Domain hit(s) vs Pfam T2SE [PF00437], Evalue: 6.5e-55, Aligned region: 22..333
FtsK_SpoIIIE [PF01580], Evalue: 4.5e-05, Aligned region: 182..208
Protein Sequence: 353 a.a.     [Download]
>gi|49474753|ref|YP_032795.1| trwD protein [Bartonella quintana str. Toulouse]
MSTASLYANPVQKDQAVAQLLQPLDSFLKDPKITELSICRPCEVWTKSFEGWKVHSVPKLTSSFLQTLIT
AIIVYNGMVPKSINYVLLPGGQRGTIVQTPAVIDGTLSFMIRKHSLMVKTLEELNEEGVLNDFTDVSFNK
PSEKEANDFLSKQDFTRLEPFEVQLLQLKRDRKILEFLEKCVFHKRNIVIAGKTGSGKTTFARSLIEKVP
TEERIITIEDVHELFLPNHPNHVHMLYGDDVDRVSADECLDACMRQSPDRIFLAELRGNEAWEYLNSLNT
GHPGSITTTHANNALQTFERCATLVKRSEIGRQLDLEMIKMVLYTTIDVVLFFKDRKLSEVFYDPVFSKS
KIT
 
Nucleotide Sequence: 1062 bp     [Download]
>gi|49473688|ref|NC_005955.1|:1477829-1478890 Bartonella quintana str. Toulouse, complete genome
ATGTCTACAGCCTCATTATACGCTAACCCAGTACAGAAAGATCAAGCAGTTGCGCAACTTCTGCAGCCGC
TTGATTCTTTCTTAAAAGATCCGAAAATTACTGAATTATCGATCTGCCGTCCCTGTGAAGTGTGGACAAA
AAGCTTCGAGGGCTGGAAGGTACATAGCGTACCAAAATTGACAAGCTCTTTTTTGCAAACGCTTATCACT
GCCATTATCGTTTATAACGGTATGGTTCCCAAAAGCATTAATTATGTGCTGTTGCCCGGAGGGCAGCGCG
GTACAATTGTGCAAACACCAGCTGTCATCGATGGCACACTCTCCTTTATGATTCGTAAACACTCCCTGAT
GGTGAAGACGCTAGAGGAACTTAATGAAGAAGGTGTACTCAATGATTTTACCGACGTAAGTTTCAATAAG
CCTTCAGAAAAAGAAGCGAATGATTTCTTATCAAAACAGGATTTTACACGATTGGAGCCATTTGAAGTTC
AACTTCTGCAACTCAAACGTGACAGAAAAATTCTTGAATTTTTGGAAAAATGCGTATTTCATAAACGCAA
TATCGTTATTGCAGGCAAAACAGGATCAGGTAAAACAACATTTGCTCGTTCCTTAATCGAAAAGGTGCCT
ACAGAAGAGCGTATTATTACGATTGAGGATGTTCATGAGCTTTTTTTACCCAATCATCCCAATCATGTGC
ATATGCTTTATGGTGACGATGTGGATCGTGTTTCAGCTGATGAGTGTTTAGATGCATGTATGCGTCAATC
GCCTGACCGTATTTTTCTGGCTGAACTGCGTGGTAATGAGGCATGGGAATATCTCAACTCATTAAATACT
GGCCATCCCGGATCAATTACCACAACACATGCCAACAATGCTTTGCAAACGTTCGAACGGTGTGCCACAT
TGGTCAAAAGATCAGAAATTGGCCGCCAACTCGATCTAGAAATGATAAAGATGGTGCTCTACACCACAAT
TGATGTAGTGCTATTCTTTAAGGATCGAAAGCTTTCTGAAGTTTTTTACGACCCAGTTTTTTCTAAATCG
AAGATAACTTAA
 Primer design