SecReT4
Protein ID: 49476015
T4SS name [ID]VirB [2]
Gene symbol-
Locus tagBH13310
StrainBartonella henselae str. Houston-1
Repliconchromosome [GenBank: NC_005956] [Browse all T4SS(s) in this replicon]
Location [Strand]1517298..1517708 [+]
Producthypothetical protein
Component typeVirB7
UniProt IDQ6G2B5, Q9RND1
KEGG IDbhe:BH13310
PDB IDNA
Domain hit(s) vs Pfam NA
Protein Sequence: 136 a.a.     [Download]
>gi|49476015|ref|YP_034056.1| hypothetical protein BH13310 [Bartonella henselae str. Houston-1]
MVHFVRCIQNKIPHALPMSSCVVFKSIYEFKKMKQKITFVMILIIALTGCASLTGPKKPPRCNGKVTRAL
NRDKWDWDNKNLILQEKNVKPVRTPIILNTLENEKATATVTLKENSLNSITRETLPENTMEIAREN
 
Nucleotide Sequence: 411 bp     [Download]
>gi|49474831|ref|NC_005956.1|:1517298-1517708 Bartonella henselae str. Houston-1 chromosome, complete genome
ATGGTGCATTTTGTAAGATGTATTCAGAACAAGATCCCCCATGCACTCCCTATGAGTTCATGCGTTGTAT
TTAAAAGTATCTATGAGTTTAAAAAAATGAAACAAAAAATAACTTTTGTTATGATCCTGATAATTGCCCT
TACAGGCTGCGCCTCTCTTACTGGCCCCAAAAAACCACCAAGATGTAATGGCAAAGTTACCCGCGCTTTA
AATAGAGATAAATGGGATTGGGACAATAAAAACCTCATCCTACAAGAAAAAAATGTAAAGCCTGTCAGGA
CTCCTATCATCCTCAACACGCTGGAAAACGAAAAAGCAACAGCGACCGTGACGTTGAAGGAAAATTCATT
GAATTCCATAACTCGTGAAACACTCCCTGAGAACACTATGGAGATTGCGCGTGAAAATTAA
 Primer design