SecReT4
Protein ID: 49476016
T4SS name [ID]VirB [2]
Gene symbolvirB8
Locus tagBH13320
StrainBartonella henselae str. Houston-1
Repliconchromosome [GenBank: NC_005956] [Browse all T4SS(s) in this replicon]
Location [Strand]1517698..1518366 [+]
ProductvirB8 protein
Component typeVirB8
UniProt IDQ6G2B4
KEGG IDbhe:BH13320
PDB IDNA
Domain hit(s) vs Pfam VirB8 [PF04335], Evalue: 4e-60, Aligned region: 12..219
Protein Sequence: 222 a.a.     [Download]
>gi|49476016|ref|YP_034057.1| virB8 protein [Bartonella henselae str. Houston-1]
MKINEFNEYIKEARSFDIDRMHGMRQRMRIAMALTVLFGLMTIALALAVAALTPLKTVEPFVIRVDNSTG
IIETVSALKETPNDYDEAITRYFASKYVRAREGFQLSEAEHNFRLVSLLSSPEEQSRFAKWYAGNNPESP
QNIYQNMIATVTIKSISFLSKDLIQVRYYKTVRELNDKENISHWVSILNFSYINAQISTQDRLINPLGFQ
VSEYRSDPEVIQ
 
Nucleotide Sequence: 669 bp     [Download]
>gi|49474831|ref|NC_005956.1|:1517698-1518366 Bartonella henselae str. Houston-1 chromosome, complete genome
GTGAAAATTAATGAATTTAATGAATATATAAAAGAAGCACGTTCCTTTGATATTGATCGCATGCATGGCA
TGCGACAACGCATGAGAATTGCCATGGCTTTAACGGTACTTTTTGGATTAATGACAATCGCCTTGGCCTT
AGCTGTAGCAGCCTTAACACCCTTAAAAACAGTAGAGCCCTTTGTGATCCGCGTTGATAATTCAACGGGC
ATTATTGAAACTGTGAGTGCCTTAAAAGAAACGCCAAACGACTATGATGAAGCGATAACACGCTATTTTG
CCAGCAAATATGTTCGTGCCCGTGAAGGTTTTCAATTATCAGAGGCGGAACATAATTTTCGCTTAGTCTC
TCTTTTATCTTCCCCAGAAGAACAAAGCCGTTTTGCGAAATGGTATGCAGGCAACAATCCAGAAAGTCCA
CAAAATATCTACCAAAACATGATTGCTACAGTCACAATCAAATCAATCTCTTTTTTAAGCAAGGATCTTA
TTCAAGTTCGTTATTATAAGACGGTCAGAGAATTGAATGACAAAGAAAATATTTCCCATTGGGTTTCGAT
CTTAAATTTTTCCTACATTAATGCACAAATTTCAACACAGGACCGATTAATTAACCCGCTTGGCTTTCAA
GTGTCGGAATATAGATCTGATCCAGAGGTGATACAATGA
 Primer design