SecReT4
Protein ID: 49476019
T4SS name [ID]VirB [2]
Gene symbolvirB11
Locus tagBH13350
StrainBartonella henselae str. Houston-1
Repliconchromosome [GenBank: NC_005956] [Browse all T4SS(s) in this replicon]
Location [Strand]1520381..1521451 [+]
ProductvirB11 protein
Component typeVirB11
UniProt IDQ9RNC7
KEGG IDbhe:BH13350
PDB IDNA
Domain hit(s) vs Pfam T2SE [PF00437], Evalue: 5.7e-96, Aligned region: 20..333
Protein Sequence: 356 a.a.     [Download]
>gi|49476019|ref|YP_034060.1| virB11 protein [Bartonella henselae str. Houston-1]
MNQNLHTLSDETVAIVLTKLEPISTFLKDENLFEIVINRPYQVMTEGVEGWKTIETPALSFNELMGIAKV
VASYSKQNISEKNPILSATLPGNERIQIVIPPAVEKNTISMTIRKPSSRSFSLEDLANKGLFSVCEQVSF
TPLNNYLSHLSELKHIDHDLVRAYAKKDFVFFLNQAVQCQKNILIAGKTGSGKTTLSKALIAKIPDDERI
ITIEDTPELVVPQPNYVSMIYSKDGQGLASVGPKELLESALRMRPDRILLQELRDGTAFYYIRNVNSGHP
GSITTVHASTALAAFEQMTLLVKESEGGGDLERDDIRGLLISMIDIIIQCKRIEGKFKVTEIYYDPFKQR
NIFGGN
 
Nucleotide Sequence: 1071 bp     [Download]
>gi|49474831|ref|NC_005956.1|:1520381-1521451 Bartonella henselae str. Houston-1 chromosome, complete genome
ATGAACCAAAACTTGCACACATTGAGCGATGAAACCGTCGCGATTGTTTTAACAAAACTAGAACCTATCA
GTACCTTTCTAAAAGATGAAAATCTTTTTGAAATTGTCATCAATCGTCCCTATCAAGTAATGACAGAAGG
GGTTGAGGGATGGAAAACCATAGAAACACCAGCTCTGTCATTTAATGAGCTTATGGGAATTGCTAAAGTT
GTAGCGTCTTATTCTAAGCAAAATATATCGGAAAAAAATCCAATATTATCAGCCACCTTACCAGGCAATG
AGCGTATTCAAATTGTTATTCCCCCTGCGGTAGAAAAAAACACCATCAGTATGACAATTCGCAAACCCTC
ATCACGGAGTTTTTCCCTCGAAGATCTGGCAAATAAAGGGCTCTTTTCGGTGTGTGAACAAGTTTCCTTC
ACGCCCTTGAATAATTATCTCTCACATTTGAGTGAACTCAAACATATTGATCATGACTTAGTCCGTGCTT
ATGCAAAGAAGGATTTTGTCTTCTTTTTAAATCAGGCTGTACAATGCCAAAAAAACATTTTGATTGCCGG
AAAAACCGGCTCGGGTAAAACAACGCTTTCAAAGGCATTAATCGCCAAAATTCCCGATGATGAACGTATT
ATCACCATTGAAGATACACCAGAATTGGTCGTTCCACAGCCTAATTATGTTTCTATGATCTATTCAAAAG
ATGGTCAAGGTTTAGCCTCTGTTGGTCCAAAAGAACTGCTTGAATCTGCTTTACGCATGCGTCCTGACCG
CATTCTTTTACAAGAGCTACGAGATGGTACCGCCTTTTATTATATCCGCAATGTTAATTCAGGACATCCA
GGTTCAATTACCACGGTTCATGCCTCAACAGCACTTGCTGCCTTTGAGCAAATGACCCTTTTGGTGAAAG
AAAGTGAGGGTGGAGGAGACTTAGAGCGTGACGATATTCGAGGGCTGTTGATTTCAATGATTGATATCAT
CATTCAATGTAAACGGATTGAGGGAAAATTTAAGGTCACAGAAATTTATTATGATCCCTTTAAACAAAGA
AACATCTTTGGTGGGAATTAA
 Primer design