SecReT4
Protein ID: 49476022
T4SS name [ID]VirB [2]
Gene symboltraG
Locus tagBH13380
StrainBartonella henselae str. Houston-1
Repliconchromosome [GenBank: NC_005956] [Browse all T4SS(s) in this replicon]
Location [Strand]1523533..1525452 [+]
Productconjugal transfer protein TraG
Component typeVirD4
Also Known asTraG
UniProt IDQ6G2A8
KEGG IDbhe:BH13380
PDB IDNA
Domain hit(s) vs Pfam T4SS-DNA_transf [PF02534], Evalue: 6.4e-103, Aligned region: 158..636
TraG-D_C [PF12696], Evalue: 4.5e-29, Aligned region: 475..593
TrwB_AAD_bind [PF10412], Evalue: 2.6e-21, Aligned region: 307..608
Protein Sequence: 639 a.a.     [Download]
>gi|49476022|ref|YP_034063.1| conjugal transfer protein TraG [Bartonella henselae str. Houston-1]
MKYTKTQLALISMPIASGALTIFLVPHMLSFVINDLKTNQIYWYVRSEPLLTLMLVAAVSLFYTLSQKLH
LRKAITFVSTAFFCITALYYIGSEIKRLNPYVGQQGITWGYALKFMDPMVVFGVILGFVLLAIQVIITSP
RTSNVKRAKKGIFGDAAWMNLKEAARIFPSNGQIVIGERYRVDQDNVRNIPFAPGNKTTWGKGGTAPLLT
FNLDFGSTHMIFFAGSGGYKTTSTVVPTCLTYTGPIVCLDPSTEIAPMVKFARKKMGNRNVIILDPNSLL
TKNFNVLDWLLDENIPRTRREANIVSFSKLLLSEKKSENSSAEYFSTQAHNLLTALLAHVIFSDKYEDSE
RNLKTLRAILSQSETAVVNQLRMIQETTPSPFIREMVGIFTEMADQTFSGVYTTASKDTQWLSLSNYADL
VCGNDFASSDIANGKTDVFLNLPASILNSYPAIGRVIIGAFLNAMVTADGNYKKRVLFVLDEVDLLGYMN
ILEEARDRGRKYGTSLMLFYQSSGQLVNHFGEAGARSWFESCSFVSYAAIKDLQTAKDISERCGQMTIEV
TGTSKSRGLSLTKGSQNINYQQRALILPHEIIQEMRQDEQIILMQGHPPLRCGRAIYFRRKEMLAATEKN
RFAPQAKKS
 
Nucleotide Sequence: 1920 bp     [Download]
>gi|49474831|ref|NC_005956.1|:1523533-1525452 Bartonella henselae str. Houston-1 chromosome, complete genome
ATGAAATATACAAAGACGCAACTGGCACTCATTTCCATGCCAATCGCTTCAGGTGCTTTAACGATATTTC
TTGTTCCTCATATGTTGTCATTTGTGATAAATGATCTGAAAACCAACCAAATCTATTGGTATGTCCGTTC
AGAACCCTTATTAACGCTGATGCTGGTTGCTGCTGTATCATTATTTTATACTCTCTCACAAAAGCTGCAC
TTGCGCAAAGCGATCACATTCGTCTCAACGGCCTTTTTTTGCATCACTGCTCTTTACTATATCGGCAGTG
AAATAAAACGCTTAAATCCCTATGTTGGACAACAGGGGATAACCTGGGGCTATGCTTTAAAATTCATGGA
TCCGATGGTTGTTTTCGGCGTCATTTTAGGCTTTGTTCTTTTAGCAATCCAAGTCATAATCACCTCTCCA
CGCACGAGCAATGTCAAACGTGCCAAAAAAGGAATTTTTGGTGACGCCGCATGGATGAATTTAAAAGAAG
CGGCAAGAATTTTTCCCTCCAATGGCCAAATTGTTATTGGCGAAAGATACCGTGTTGATCAAGATAATGT
TCGCAACATTCCCTTTGCACCAGGCAATAAAACAACATGGGGCAAGGGTGGAACAGCCCCTTTGCTGACC
TTTAATCTTGATTTTGGTTCAACGCACATGATTTTTTTCGCCGGTTCTGGTGGATATAAAACAACAAGCA
CAGTGGTTCCAACCTGTCTAACCTACACAGGCCCTATTGTTTGCCTTGATCCTTCAACAGAAATTGCACC
CATGGTCAAGTTTGCGCGCAAAAAAATGGGCAATAGAAATGTTATTATTCTCGATCCCAATTCGCTCTTA
ACAAAAAATTTTAATGTGCTCGATTGGCTTTTAGACGAAAATATACCGCGCACAAGGCGTGAAGCCAATA
TTGTGAGCTTTTCCAAACTGCTTCTCTCAGAGAAAAAATCAGAAAATTCTTCAGCAGAATATTTTTCAAC
ACAAGCGCATAATCTTTTAACCGCACTTCTTGCACATGTAATCTTCTCTGATAAATATGAAGACAGTGAG
CGTAATCTCAAAACATTACGCGCGATCCTCTCTCAGTCAGAAACAGCTGTTGTCAATCAATTACGTATGA
TTCAAGAAACAACACCGTCTCCTTTTATTCGTGAAATGGTTGGTATTTTCACGGAAATGGCAGATCAAAC
CTTTTCAGGGGTCTACACAACTGCCTCCAAAGACACCCAATGGCTTTCTTTGTCAAATTACGCTGATCTT
GTTTGTGGGAATGATTTTGCATCCTCGGATATTGCAAACGGAAAAACAGATGTTTTTCTTAATCTTCCTG
CCAGTATTTTGAACAGTTATCCAGCGATTGGCCGCGTGATCATTGGCGCTTTTTTAAATGCGATGGTTAC
AGCAGATGGAAACTATAAAAAGCGTGTTTTGTTTGTCTTGGATGAAGTCGATCTTCTTGGTTATATGAAT
ATTTTAGAAGAAGCACGTGATCGTGGGCGTAAGTACGGCACATCCTTGATGCTTTTTTATCAATCCTCTG
GTCAGTTGGTTAATCACTTTGGAGAAGCAGGAGCGCGTTCATGGTTTGAAAGCTGCTCTTTTGTGAGTTA
CGCCGCCATTAAAGATCTCCAAACAGCCAAAGACATTTCGGAACGCTGTGGTCAAATGACCATTGAAGTA
ACTGGAACGAGCAAATCGAGAGGTTTGTCTTTAACAAAAGGTTCTCAAAACATCAACTATCAACAAAGAG
CACTGATTTTACCCCACGAGATTATTCAAGAGATGCGCCAAGATGAACAAATTATTCTTATGCAAGGGCA
CCCCCCTTTACGATGCGGTCGAGCGATCTATTTTAGAAGGAAAGAGATGTTAGCAGCTACTGAAAAAAAC
CGCTTTGCCCCACAAGCAAAGAAAAGCTGA
 Primer design