SecReT4
Protein ID: 49476210
T4SS name [ID]Trw [3]
Gene symboltrwN
Locus tagBH15550
StrainBartonella henselae str. Houston-1
Repliconchromosome [GenBank: NC_005956] [Browse all T4SS(s) in this replicon]
Location [Strand]1803062..1803730 [+]
ProducttrwN protein
Component typeTrwN
UniProt IDQ6G1U6
KEGG IDbhe:BH15550
PDB IDNA
Domain hit(s) vs Pfam NA
Protein Sequence: 222 a.a.     [Download]
>gi|49476210|ref|YP_034251.1| trwN protein [Bartonella henselae str. Houston-1]
MTIPGFMMFAAACAPAIHPTTFSAVDIQESSDYISVRSTNDDPKVSRQSSMFEETVATVEQFKQCGRNFD
ISLRQINVRNLEYFGVSLSDLFNLCENLKAIQAVVADCSEREKLEYGSEKTTLQSVLSFYNTKSFKGTFS
TAYVQKVASHIGVQVSAPLSQKSQESIELSTEQPEQIIETETFPLSSEDLEDAFTHNASSVGDVFTTEDS
SLTAETSSSFER
 
Nucleotide Sequence: 669 bp     [Download]
>gi|49474831|ref|NC_005956.1|:1803062-1803730 Bartonella henselae str. Houston-1 chromosome, complete genome
ATGACTATTCCAGGCTTTATGATGTTCGCTGCCGCATGTGCGCCCGCTATTCATCCTACGACATTTTCAG
CTGTCGACATACAAGAATCATCGGATTATATCTCTGTAAGAAGCACAAATGATGACCCTAAAGTTTCACG
TCAATCTTCCATGTTTGAGGAAACAGTCGCAACAGTTGAACAATTTAAGCAGTGTGGGCGTAATTTCGAC
ATTAGTTTGAGACAAATTAACGTCAGAAATTTGGAATATTTTGGCGTGTCTCTCTCTGATTTATTTAACC
TCTGCGAAAATCTCAAAGCTATACAAGCTGTTGTAGCAGACTGTTCTGAACGTGAAAAATTAGAGTACGG
CTCTGAAAAAACTACGTTGCAATCTGTGCTAAGCTTTTACAACACGAAAAGCTTCAAGGGTACTTTTAGC
ACCGCTTATGTGCAAAAAGTTGCCTCACATATTGGAGTGCAAGTTTCTGCGCCTCTCAGTCAAAAGTCAC
AAGAATCTATAGAGCTTAGCACAGAACAGCCAGAACAAATAATAGAGACAGAAACTTTTCCTCTTTCCTC
AGAAGACTTGGAAGATGCTTTTACCCATAATGCAAGCAGCGTTGGTGATGTTTTTACAACAGAAGATTCC
TCTTTGACAGCAGAAACTTCTTCTTCATTCGAAAGATAG
 Primer design