SecReT4
Protein ID: 49476212
T4SS name [ID]Trw [3]
Gene symboltrwL1
Locus tagBH15570
StrainBartonella henselae str. Houston-1
Repliconchromosome [GenBank: NC_005956] [Browse all T4SS(s) in this replicon]
Location [Strand]1804130..1804447 [+]
Productconjugal transfer protein TrwL
Component typeTrwL
UniProt IDQ6G1U4
KEGG IDbhe:BH15570
PDB IDNA
Domain hit(s) vs Pfam TrbC [PF04956], Evalue: 2.7e-20, Aligned region: 8..101
Protein Sequence: 105 a.a.     [Download]
>gi|49476212|ref|YP_034253.1| conjugal transfer protein TrwL [Bartonella henselae str. Houston-1]
MKRFNMLPAIAHNKTIATVAAFTVFLMTHPVYAQAQGLKNAGDVLKKLQTELKAIIPIAAAVILLCLAIG
YAGRYIEKDTFVRWSVGVIIAGSAAELANMLFKAN
 
Nucleotide Sequence: 318 bp     [Download]
>gi|49474831|ref|NC_005956.1|:1804130-1804447 Bartonella henselae str. Houston-1 chromosome, complete genome
ATGAAACGATTCAATATGCTTCCAGCAATAGCTCATAATAAAACCATTGCAACTGTTGCAGCTTTCACCG
TATTCCTTATGACTCATCCTGTATATGCTCAAGCACAAGGTTTAAAAAATGCAGGAGATGTTTTAAAAAA
ACTCCAGACTGAATTGAAGGCGATTATTCCAATTGCTGCTGCTGTTATACTTTTGTGCTTAGCAATTGGT
TACGCAGGACGTTACATAGAGAAAGATACATTTGTACGCTGGTCAGTTGGTGTCATCATCGCTGGATCAG
CAGCTGAACTTGCCAACATGTTATTTAAAGCAAACTAA
 Primer design