SecReT4
Protein ID: 49476213
T4SS name [ID]Trw [3]
Gene symboltrwL2
Locus tagBH15580
StrainBartonella henselae str. Houston-1
Repliconchromosome [GenBank: NC_005956] [Browse all T4SS(s) in this replicon]
Location [Strand]1804494..1804805 [+]
Productconjugal transfer protein TrwL
Component typeTrwL
UniProt IDQ6G1U3
KEGG IDbhe:BH15580
PDB IDNA
Domain hit(s) vs Pfam TrbC [PF04956], Evalue: 5.3e-21, Aligned region: 2..98
Protein Sequence: 103 a.a.     [Download]
>gi|49476213|ref|YP_034254.1| conjugal transfer protein TrwL [Bartonella henselae str. Houston-1]
MKQLSNLRSKNNNRIVEIAAAMTVFFITCPAYAALDHAKKALDTLQNDLIKNIIPVAAAIILLCLAIGYA
GRYIEKDTFIRWAIGVVIAGSATQLVTLLFTKQ
 
Nucleotide Sequence: 312 bp     [Download]
>gi|49474831|ref|NC_005956.1|:1804494-1804805 Bartonella henselae str. Houston-1 chromosome, complete genome
ATGAAACAATTAAGTAATCTTCGATCAAAAAATAACAATAGGATTGTAGAAATTGCTGCGGCTATGACTG
TATTCTTTATAACTTGTCCTGCATATGCCGCACTAGATCATGCAAAAAAGGCTTTAGACACCTTGCAGAA
TGACCTTATTAAAAACATCATTCCTGTTGCAGCTGCTATCATACTTTTGTGCTTAGCGATTGGTTATGCA
GGCCGCTACATCGAAAAGGATACATTTATACGGTGGGCTATTGGCGTTGTTATCGCTGGATCAGCAACCC
AACTTGTTACCTTATTATTCACCAAACAATAA
 Primer design