SecReT4
Protein ID: 49476214
T4SS name [ID]Trw [3]
Gene symboltrwL3
Locus tagBH15590
StrainBartonella henselae str. Houston-1
Repliconchromosome [GenBank: NC_005956] [Browse all T4SS(s) in this replicon]
Location [Strand]1804829..1805152 [+]
Productconjugal transfer protein TrwL
Component typeTrwL
UniProt IDQ6G1U2
KEGG IDbhe:BH15590
PDB IDNA
Domain hit(s) vs Pfam TrbC [PF04956], Evalue: 3.4e-19, Aligned region: 7..103
Protein Sequence: 107 a.a.     [Download]
>gi|49476214|ref|YP_034255.1| conjugal transfer protein TrwL [Bartonella henselae str. Houston-1]
MKQSNIFQSKINNKILTTTATITVFVIAHPVCAQAQQGGLTNAKKALEDFKKQLDIIIPIAAAVILLCLA
IGYAGRYIEKDTFVRWSVGVIIAGSAAELAGMLFKAT
 
Nucleotide Sequence: 324 bp     [Download]
>gi|49474831|ref|NC_005956.1|:1804829-1805152 Bartonella henselae str. Houston-1 chromosome, complete genome
ATGAAACAATCAAATATTTTTCAATCAAAAATCAACAATAAAATCCTCACGACTACAGCAACTATAACCG
TATTTGTTATAGCGCATCCTGTATGTGCTCAAGCACAGCAAGGTGGTTTAACTAATGCGAAAAAAGCTTT
AGAAGATTTTAAAAAACAATTGGATATAATTATTCCTATTGCCGCTGCTGTTATACTTTTGTGCTTAGCG
ATTGGTTACGCAGGGCGTTACATAGAGAAGGATACATTTGTACGCTGGTCAGTCGGCGTGATTATCGCTG
GTTCAGCCGCCGAACTTGCAGGTATGTTATTCAAAGCAACATGA
 Primer design