SecReT4
Protein ID: 49476216
T4SS name [ID]Trw [3]
Gene symboltrwL5
Locus tagBH15610
StrainBartonella henselae str. Houston-1
Repliconchromosome [GenBank: NC_005956] [Browse all T4SS(s) in this replicon]
Location [Strand]1805661..1805969 [+]
Productconjugal transfer protein TrwL
Component typeTrwL
UniProt IDQ6G1U0
KEGG IDbhe:BH15610
PDB IDNA
Domain hit(s) vs Pfam TrbC [PF04956], Evalue: 1.1e-17, Aligned region: 1..97
Protein Sequence: 102 a.a.     [Download]
>gi|49476216|ref|YP_034257.1| conjugal transfer protein TrwL [Bartonella henselae str. Houston-1]
MKRLINLQSKNNNRIIVIAASITVFFIGSPVYAKLTNAANALKNLKEELTGKIIPVAAAVILLCLAIGYA
GRYIGKDTFIRWAIGVVIAGSAVQLTGLLFTP
 
Nucleotide Sequence: 309 bp     [Download]
>gi|49474831|ref|NC_005956.1|:1805661-1805969 Bartonella henselae str. Houston-1 chromosome, complete genome
ATGAAACGATTAATTAATCTCCAATCAAAAAATAACAACAGGATTATCGTAATTGCTGCATCTATAACTG
TGTTTTTTATAGGTAGTCCTGTGTATGCTAAATTAACAAACGCTGCAAATGCTCTGAAAAATCTGAAGGA
AGAACTTACTGGAAAAATTATCCCTGTTGCCGCTGCTGTTATACTTTTGTGTTTAGCAATTGGTTATGCA
GGACGTTACATCGGAAAGGATACGTTTATACGGTGGGCTATTGGCGTCGTCATTGCTGGCTCAGCAGTCC
AACTTACCGGTCTTCTGTTCACCCCCTAA
 Primer design