SecReT4
Protein ID: 49476218
T4SS name [ID]Trw [3]
Gene symboltrwL7
Locus tagBH15630
StrainBartonella henselae str. Houston-1
Repliconchromosome [GenBank: NC_005956] [Browse all T4SS(s) in this replicon]
Location [Strand]1806567..1806881 [+]
Productconjugal transfer protein TrwL
Component typeTrwL
UniProt IDQ6G1T8
KEGG IDbhe:BH15630
PDB IDNA
Domain hit(s) vs Pfam TrbC [PF04956], Evalue: 1.3e-21, Aligned region: 1..100
Protein Sequence: 104 a.a.     [Download]
>gi|49476218|ref|YP_034259.1| conjugal transfer protein TrwL [Bartonella henselae str. Houston-1]
MKQLNNLKSKINNKIIAIAAVMTVFFRGSPVYAQKNLENAKNALSSLHTELTGKIIPVAAAVILLCLAIG
YAGRYIEKDTFIRWAIGVVIAGSASELVALLFTT
 
Nucleotide Sequence: 315 bp     [Download]
>gi|49474831|ref|NC_005956.1|:1806567-1806881 Bartonella henselae str. Houston-1 chromosome, complete genome
ATGAAACAATTAAATAATCTCAAATCAAAAATTAACAACAAGATTATCGCAATTGCCGCAGTTATGACGG
TGTTTTTTAGGGGTAGTCCTGTATATGCCCAAAAAAATTTAGAAAACGCTAAAAATGCTTTGAGCAGTCT
ACACACAGAACTTACAGGCAAAATTATTCCTGTTGCTGCTGCTGTTATACTTTTGTGCTTAGCAATTGGC
TATGCCGGGCGCTACATCGAAAAGGATACGTTTATACGGTGGGCTATTGGCGTTGTCATTGCTGGCTCAG
CAAGCGAACTTGTCGCACTATTGTTTACTACTTAA
 Primer design