SecReT4
Protein ID: 49476219
T4SS name [ID]Trw [3]
Gene symboltrwL8
Locus tagBH15640
StrainBartonella henselae str. Houston-1
Repliconchromosome [GenBank: NC_005956] [Browse all T4SS(s) in this replicon]
Location [Strand]1807042..1807353 [+]
Productconjugal transfer protein TrwL
Component typeTrwL
UniProt IDQ6G1T7
KEGG IDbhe:BH15640
PDB IDNA
Domain hit(s) vs Pfam NA
Protein Sequence: 103 a.a.     [Download]
>gi|49476219|ref|YP_034260.1| conjugal transfer protein TrwL [Bartonella henselae str. Houston-1]
MESLNILRTKTVRKISFIFTALVVFLTTQPSCAQTTSKGLEILIGMQYGLGIIIPIFAAIILFFLLLIYM
CRIISRITFARWAFSVIIAGAAFYISSILFYIN
 
Nucleotide Sequence: 312 bp     [Download]
>gi|49474831|ref|NC_005956.1|:1807042-1807353 Bartonella henselae str. Houston-1 chromosome, complete genome
ATGGAAAGCTTAAATATTCTTCGAACAAAAACTGTTAGAAAAATTAGTTTTATTTTTACAGCTTTGGTTG
TGTTTTTAACGACTCAACCTAGTTGTGCCCAAACAACAAGCAAAGGTTTAGAAATCCTCATAGGTATGCA
GTATGGGTTAGGTATCATTATTCCCATTTTTGCTGCCATCATTCTTTTCTTTCTCCTGCTTATTTATATG
TGTCGCATCATCTCAAGGATTACATTTGCGCGATGGGCGTTTAGTGTCATCATTGCTGGAGCAGCATTTT
ATATTAGCAGCATATTGTTTTACATAAACTAA
 Primer design