SecReT4
Protein ID: 49476222
T4SS name [ID]Trw [3]
Gene symboltrwJ1
Locus tagBH15670
StrainBartonella henselae str. Houston-1
Repliconchromosome [GenBank: NC_005956] [Browse all T4SS(s) in this replicon]
Location [Strand]1810145..1810933 [+]
Productconjugal transfer protein TrwJ
Component typeTrwJ
UniProt IDQ6G1T4
KEGG IDbhe:BH15670
PDB IDNA
Domain hit(s) vs Pfam T4SS [PF07996], Evalue: 4.3e-51, Aligned region: 55..242
Protein Sequence: 262 a.a.     [Download]
>gi|49476222|ref|YP_034263.1| conjugal transfer protein TrwJ [Bartonella henselae str. Houston-1]
MKKMIFTITISAILATQSPALAVPFGSSWISGNSFGITRLGDTWDYRDFTTLGGFNLPKLRHAEKMEEEL
QKLFIEHEKKQKQKDLKITNDILEKIYKSITGKRDLGIAALDSTSFFLKNPEYIYDPDKNSGMSSSVKSI
LQKEQISDIREARKSIEGREQYATVVDKAVSFQTFQEAENRFKQIAKMLADVEKTKDLKDIAELQAHIKS
KLAMIQNESAKLQMVAHLRNAEQGLINQQKHKRNMKILDSKNTAMPTIRSIR
 
Nucleotide Sequence: 789 bp     [Download]
>gi|49474831|ref|NC_005956.1|:1810145-1810933 Bartonella henselae str. Houston-1 chromosome, complete genome
ATGAAAAAAATGATTTTTACAATAACGATAAGTGCAATTCTTGCAACGCAAAGCCCGGCTCTTGCAGTTC
CTTTTGGAAGTTCTTGGATTAGTGGAAATTCTTTTGGTATAACCCGTTTGGGAGATACTTGGGATTATAG
AGATTTCACTACCCTTGGAGGGTTTAATCTTCCTAAATTGCGACATGCAGAAAAAATGGAAGAGGAATTA
CAAAAGCTATTTATAGAACACGAAAAGAAGCAGAAGCAAAAGGACTTAAAGATAACCAACGATATACTTG
AAAAAATATATAAGTCTATAACAGGAAAACGAGATTTGGGCATTGCAGCACTAGATTCTACCAGTTTTTT
TCTCAAAAACCCAGAGTATATCTACGATCCGGATAAAAATTCTGGTATGTCTTCATCAGTCAAAAGCATT
CTACAAAAGGAACAAATTTCTGATATCCGTGAAGCTCGAAAATCTATTGAAGGACGCGAACAATACGCAA
CGGTTGTCGATAAAGCCGTAAGTTTTCAAACTTTTCAAGAAGCAGAAAATCGTTTTAAACAAATTGCAAA
AATGTTAGCCGACGTCGAAAAAACAAAAGATCTGAAAGATATTGCCGAATTACAAGCGCATATTAAAAGT
AAATTAGCTATGATCCAAAACGAAAGTGCAAAATTGCAAATGGTTGCGCATCTACGCAACGCAGAACAAG
GACTTATCAACCAACAAAAACACAAACGTAATATGAAAATTCTTGATAGTAAAAATACAGCAATGCCAAC
TATACGGTCTATACGGTAA
 Primer design