SecReT4
Protein ID: 49476224
T4SS name [ID]Trw [3]
Gene symboltrwH1
Locus tagBH15690
StrainBartonella henselae str. Houston-1
Repliconchromosome [GenBank: NC_005956] [Browse all T4SS(s) in this replicon]
Location [Strand]1812216..1812362 [+]
Producthypothetical protein
Component typeTrwH
UniProt IDQ6G1T2
KEGG IDbhe:BH15690
PDB IDNA
Domain hit(s) vs Pfam NA
Protein Sequence: 48 a.a.     [Download]
>gi|49476224|ref|YP_034265.1| hypothetical protein BH15690 [Bartonella henselae str. Houston-1]
MKSIIFAILIAGLLSACGTLAPKPKQPNNWNRVPINKTVPTEIQRGAI
 
Nucleotide Sequence: 147 bp     [Download]
>gi|49474831|ref|NC_005956.1|:1812216-1812362 Bartonella henselae str. Houston-1 chromosome, complete genome
ATGAAGTCAATCATTTTTGCAATTTTGATTGCTGGGCTTTTATCAGCTTGCGGTACATTAGCTCCAAAGC
CAAAACAACCCAATAATTGGAATCGCGTGCCTATTAACAAAACAGTCCCTACCGAAATTCAACGAGGAGC
AATATGA
 Primer design