SecReT4
Protein ID: 49476225
T4SS name [ID]Trw [3]
Gene symboltrwJ2
Locus tagBH15700
StrainBartonella henselae str. Houston-1
Repliconchromosome [GenBank: NC_005956] [Browse all T4SS(s) in this replicon]
Location [Strand]1812359..1812985 [+]
Productconjugal transfer protein TrwJ
Component typeTrwJ
UniProt IDQ6G1T1
KEGG IDbhe:BH15700
PDB IDNA
Domain hit(s) vs Pfam T4SS [PF07996], Evalue: 1.4e-30, Aligned region: 34..190
Protein Sequence: 208 a.a.     [Download]
>gi|49476225|ref|YP_034266.1| conjugal transfer protein TrwJ [Bartonella henselae str. Houston-1]
MRKLVIIVTVSAIFTTLNLAKSNNVREKDISLLADKIHQSITGTRTPTPQKKEDDGTLLFSNPQHIYDQE
KQNNIAKQIPKLFKETMKNESYLRNSPVDEARETIDERSQYAAVIDKAVALQTFQETEKRFEQIANILVE
IPKMNDLKGIAELQVRMKGMLAMIQNEATKLQMVTHLSNTEQALINRLKRKRNVQILQQINKKMPTIR
 
Nucleotide Sequence: 627 bp     [Download]
>gi|49474831|ref|NC_005956.1|:1812359-1812985 Bartonella henselae str. Houston-1 chromosome, complete genome
ATGAGAAAGTTAGTTATTATAGTAACAGTAAGTGCTATTTTTACAACACTCAACTTAGCAAAAAGTAATA
ACGTCAGAGAAAAAGATATTTCTCTTTTGGCAGACAAGATACATCAATCTATAACAGGAACTCGAACACC
AACCCCACAGAAAAAAGAAGATGACGGCACTTTATTATTTTCAAATCCACAACATATCTACGATCAAGAG
AAACAAAACAATATTGCTAAACAGATCCCGAAATTATTTAAAGAAACTATGAAAAATGAAAGTTATCTTC
GCAATTCTCCCGTAGATGAGGCACGCGAAACTATTGATGAGCGCAGTCAATATGCAGCAGTTATAGATAA
AGCCGTAGCTTTGCAGACTTTTCAGGAAACAGAAAAACGTTTTGAACAAATTGCAAACATCTTGGTCGAG
ATACCCAAAATGAACGATTTAAAAGGTATTGCCGAGTTACAAGTGCGTATGAAAGGTATGCTAGCTATGA
TCCAAAATGAAGCAACAAAACTACAAATGGTCACGCATTTAAGCAACACCGAGCAAGCACTTATCAATCG
GCTAAAACGTAAGCGCAATGTGCAAATTCTTCAGCAAATAAACAAAAAAATGCCAACTATACGGTAG
 Primer design