SecReT4
Protein ID: 49476227
T4SS name [ID]Trw [3]
Gene symboltrwH2
Locus tagBH15720
StrainBartonella henselae str. Houston-1
Repliconchromosome [GenBank: NC_005956] [Browse all T4SS(s) in this replicon]
Location [Strand]1814293..1814439 [+]
Producthypothetical protein
Component typeTrwH
UniProt IDQ70XR6, Q4L2V4
KEGG IDbhe:BH15720
PDB IDNA
Domain hit(s) vs Pfam NA
Protein Sequence: 48 a.a.     [Download]
>gi|49476227|ref|YP_034268.1| hypothetical protein BH15720 [Bartonella henselae str. Houston-1]
MKSIIFATLIAGLLSACGTLAPKPKQPNNWNRVPVNKTVPIEIQRGAI
 
Nucleotide Sequence: 147 bp     [Download]
>gi|49474831|ref|NC_005956.1|:1814293-1814439 Bartonella henselae str. Houston-1 chromosome, complete genome
ATGAAATCAATCATTTTTGCAACTTTAATTGCTGGGCTTTTATCAGCTTGCGGTACGTTAGCTCCAAAGC
CAAAACAACCTAATAATTGGAATCGCGTGCCTGTTAACAAAACAGTCCCTATCGAAATTCAACGAGGAGC
AATATGA
 Primer design