SecReT4
Protein ID: 49476228
T4SS name [ID]Trw [3]
Gene symboltrwG
Locus tagBH15730
StrainBartonella henselae str. Houston-1
Repliconchromosome [GenBank: NC_005956] [Browse all T4SS(s) in this replicon]
Location [Strand]1814436..1815134 [+]
ProducttrwG protein
Component typeTrwG
UniProt IDQ70XR5, Q4L2V3
KEGG IDbhe:BH15730
PDB IDNA
Domain hit(s) vs Pfam VirB8 [PF04335], Evalue: 4.8e-56, Aligned region: 22..227
Protein Sequence: 232 a.a.     [Download]
>gi|49476228|ref|YP_034269.1| trwG protein [Bartonella henselae str. Houston-1]
MTKKQVKPIKAEQLNSYYEESRGLERELISEFIKSRKTAWRVAGVVGVFGLFGMMCGVVGFSQPAPTPLV
LRVDNTTGAVDVISVMREHETSYGEVVDRYWLNQYVLNRETYDYDTIQLNYDTAALLSAPTVQQEFYKIY
EGENARDQVLSNKARIIVKVRSIQPNGLGQATVRFTTQQYNSNGTAEAKQHQIATIGYTYVGAPMKSSDR
LLNPLGFQVTSYRADPEILLNN
 
Nucleotide Sequence: 699 bp     [Download]
>gi|49474831|ref|NC_005956.1|:1814436-1815134 Bartonella henselae str. Houston-1 chromosome, complete genome
ATGACAAAAAAACAAGTAAAACCAATAAAAGCCGAACAACTAAATAGCTACTATGAAGAAAGCCGCGGCT
TGGAACGTGAACTCATCAGCGAATTTATAAAGTCGCGTAAAACAGCGTGGCGAGTAGCAGGTGTTGTTGG
GGTTTTTGGATTATTCGGCATGATGTGCGGGGTTGTCGGCTTTTCCCAACCAGCACCCACTCCCTTGGTA
TTACGCGTTGATAACACAACTGGTGCAGTTGATGTTATTTCTGTGATGCGCGAACATGAAACCAGCTATG
GTGAGGTTGTGGATAGGTATTGGCTTAATCAGTATGTGCTTAACCGTGAAACTTATGATTATGACACCAT
TCAACTGAATTATGATACTGCAGCGCTTTTAAGTGCCCCAACTGTTCAACAGGAGTTTTACAAAATCTAT
GAAGGTGAAAATGCGCGCGACCAAGTGCTTTCCAACAAAGCGCGGATTATAGTCAAAGTACGCTCGATTC
AACCAAACGGTCTTGGTCAAGCAACCGTGCGTTTTACAACGCAACAATACAACAGCAACGGTACAGCTGA
AGCAAAACAACACCAAATTGCAACAATTGGTTACACCTATGTTGGTGCGCCAATGAAATCATCTGATCGA
TTGCTTAATCCCCTTGGTTTCCAAGTTACAAGTTACCGCGCTGACCCGGAAATACTTTTGAATAATTAA
 Primer design