SecReT4
Protein ID: 49476229
T4SS name [ID]Trw [3]
Gene symboltrwF
Locus tagBH15740
StrainBartonella henselae str. Houston-1
Repliconchromosome [GenBank: NC_005956] [Browse all T4SS(s) in this replicon]
Location [Strand]1815148..1815954 [+]
ProducttrwF protein
Component typeTrwF
UniProt IDQ6G1S7, Q70XR4
KEGG IDbhe:BH15740
PDB IDNA
Domain hit(s) vs Pfam CagX [PF03524], Evalue: 6.2e-61, Aligned region: 33..242
Protein Sequence: 268 a.a.     [Download]
>gi|49476229|ref|YP_034270.1| trwF protein [Bartonella henselae str. Houston-1]
MKKLAFMAFLSSFSFFYTVPVQALKTPSSSEYDHRIRYVTYNVADVVQIETVIGVATHIILEEGERYITH
AFGDSEAYAFAHKGRHIFIKPKAELANTNLIVVTDKRSYKFRLQFRNDRAGATYELAFHYPDTNTQNLEE
NKQRLAIERGFHQSVNGYNLSYTMSGNQDIAPINAWDNGRITYFKFPANMDMPSIYLVDAEGNESLISRT
VVGNSNDIIAVHKVNPKWLIRLGKRALAVFNEAYDSNGIPNTTGTISSVVHRINKGGK
 
Nucleotide Sequence: 807 bp     [Download]
>gi|49474831|ref|NC_005956.1|:1815148-1815954 Bartonella henselae str. Houston-1 chromosome, complete genome
ATGAAAAAACTTGCATTTATGGCCTTTTTATCCTCATTTTCCTTTTTTTATACGGTACCCGTGCAAGCGC
TCAAAACTCCATCTAGTTCAGAATATGATCATCGCATTCGCTATGTAACGTATAATGTAGCTGATGTGGT
TCAGATTGAAACCGTTATCGGTGTGGCAACCCATATCATTCTTGAAGAAGGTGAGCGCTATATCACTCAT
GCATTTGGTGATTCTGAAGCCTATGCCTTTGCACATAAAGGACGTCATATCTTTATTAAACCCAAAGCAG
AACTTGCCAATACAAACCTCATTGTTGTAACTGATAAGCGTAGCTACAAATTCCGACTACAGTTCCGTAA
TGACCGTGCTGGAGCAACCTACGAATTAGCTTTCCATTATCCAGATACAAACACCCAAAATCTAGAAGAA
AACAAACAACGCCTTGCCATTGAACGTGGTTTTCATCAAAGCGTAAATGGTTATAACCTTAGCTACACCA
TGAGCGGCAACCAAGATATTGCCCCGATAAACGCTTGGGACAATGGACGTATTACCTATTTCAAATTTCC
AGCCAACATGGATATGCCCTCAATTTACCTAGTTGATGCCGAAGGCAATGAAAGTTTAATATCACGTACT
GTTGTAGGAAATTCAAATGATATCATCGCTGTTCATAAGGTTAATCCTAAATGGCTCATACGACTTGGCA
AACGCGCTTTAGCTGTTTTCAACGAAGCCTATGACTCCAATGGTATACCAAACACAACTGGAACAATATC
CTCGGTGGTTCACCGCATCAATAAAGGAGGCAAATGA
 Primer design