SecReT4
Protein ID: 49476230
T4SS name [ID]Trw [3]
Gene symboltrwE
Locus tagBH15750
StrainBartonella henselae str. Houston-1
Repliconchromosome [GenBank: NC_005956] [Browse all T4SS(s) in this replicon]
Location [Strand]1815954..1817141 [+]
ProducttrwE protein
Component typeTrwE
UniProt IDQ6G1S6
KEGG IDbhe:BH15750
PDB IDNA
Domain hit(s) vs Pfam TrbI [PF03743], Evalue: 3.4e-61, Aligned region: 208..386
Protein Sequence: 395 a.a.     [Download]
>gi|49476230|ref|YP_034271.1| trwE protein [Bartonella henselae str. Houston-1]
MFGNKKGDEINKGAEQNYAEQKHEKSYTEYIEGAYGSSELASERRPIIPGARTLLIVGLIVIVAVPIALT
WKALKMRNTVNVEEEKPQQTVQQIIPSYTPRVIEEPKVIEEPEKPTQTEELTQSIPPALAQLLQTTMPPH
LMQDSEELARKRMLSSGLNNGGSSESSSEHPKGNTSGNERNNGVLFDQLQPVRLGQSHAAQLHNRDLLIT
QGTQIDCTLETKIVTSQPGMTTCHLTRDVYSTSGRVVLLDRGSKVVGFYQSGIQQGQTRVFVQWSRIETP
SGVIINLDSPGTGPLGEAGIGGWIDTHFWQRFSGAIMVSIIGNLGEWVKGKINYGNKEKSSSQNAPQQSP
ELMVNEILQSSINIPPTLYKNQGERVNIFIARDLDFSDVYSLVTR
 
Nucleotide Sequence: 1188 bp     [Download]
>gi|49474831|ref|NC_005956.1|:1815954-1817141 Bartonella henselae str. Houston-1 chromosome, complete genome
ATGTTTGGCAATAAGAAAGGAGATGAAATCAACAAAGGTGCAGAACAAAACTACGCCGAGCAAAAACATG
AAAAAAGCTATACCGAATATATTGAAGGTGCGTATGGTAGCTCCGAATTAGCTTCGGAACGCCGTCCAAT
AATCCCCGGTGCACGTACATTGTTAATAGTAGGACTCATCGTCATAGTAGCAGTACCGATTGCTTTGACT
TGGAAGGCTTTAAAAATGCGCAATACTGTAAATGTTGAAGAAGAAAAGCCTCAACAAACGGTACAACAAA
TTATACCGAGCTATACCCCTCGTGTCATAGAAGAACCGAAAGTAATAGAAGAACCAGAAAAACCAACACA
AACAGAAGAGCTAACGCAATCCATTCCACCAGCCTTAGCACAGCTGCTTCAAACAACGATGCCACCACAT
TTGATGCAGGATTCTGAGGAATTGGCACGCAAGCGTATGTTAAGTTCCGGTCTTAACAACGGTGGTAGTA
GTGAAAGCTCTTCAGAGCATCCAAAAGGCAACACATCCGGTAATGAAAGAAATAATGGCGTATTATTCGA
TCAGCTCCAGCCTGTACGATTAGGTCAATCCCATGCGGCTCAACTCCATAACCGTGATCTATTAATTACG
CAGGGAACACAGATAGATTGCACGCTGGAAACAAAGATCGTTACATCGCAGCCAGGAATGACAACATGTC
ATTTAACACGGGATGTTTATTCTACGAGTGGTCGCGTTGTTTTGCTAGACCGTGGTTCCAAAGTCGTTGG
TTTCTATCAAAGCGGCATACAACAAGGACAAACACGTGTTTTCGTGCAATGGTCGCGTATTGAAACCCCT
TCTGGTGTTATCATCAATCTTGACTCTCCCGGTACAGGCCCCCTTGGTGAAGCTGGTATCGGTGGTTGGA
TTGATACACATTTTTGGCAACGATTTAGTGGTGCAATCATGGTGAGCATCATCGGTAATTTGGGAGAATG
GGTAAAAGGCAAAATTAATTACGGAAATAAGGAAAAATCATCATCTCAAAATGCACCACAACAGAGTCCT
GAATTAATGGTTAATGAAATTCTTCAAAGCTCCATCAACATTCCGCCAACACTTTACAAAAACCAAGGCG
AGCGAGTAAATATTTTTATTGCTCGTGATCTGGATTTCAGCGATGTCTACAGTCTCGTTACACGTTAA
 Primer design