SecReT4
Protein ID: 49483478
T4SS name [ID]Ydd [621]
Gene symbol-
Locus tagSAR1292
StrainStaphylococcus aureus subsp. aureus MRSA252
Repliconchromosome [GenBank: NC_002952] [Browse all T4SS(s) in this replicon]
Location [Strand]1356355..1357713 [-]
ProductFtsK/SpoIIIE family protein
Component typeYdcQ
UniProt IDQ6GHC0
KEGG IDsar:SAR1292
PDB IDNA
Domain hit(s) vs Pfam FtsK_SpoIIIE [PF01580], Evalue: 1.1e-23, Aligned region: 209..369
Protein Sequence: 452 a.a.     [Download]
>gi|49483478|ref|YP_040702.1| FtsK/SpoIIIE family protein [Staphylococcus aureus subsp. aureus MRSA252]
MAMNEIALFKGVRIQPYQKYIDFMFAGVLAFIFLVYRIYILFIDYKSVNKKLDIWTLFAYFKPHLLYLLI
GTAIIFVICKLIAQLLIRFKTKDLAEMIETQGFHNRTVIKKTTEYIPIDYKQTEYDYYPTMFYKRGKKTF
VIHIKKDGSRFQDNYLELETIIEPMFNSELVEKKHIGRYLRYEFMPLKYKKRIVMNGEQESNTIFYDTKI
AITHQITWDFVKAPHGLVTGITGGGKTYFLFYVIRELFRRHSEVRLLDPKVSDLSFMKRVIGDDKVADTK
GQILKQLREANNEMEERFRLMNDSSDYKIGNDFRNFDMRPYFIIFDEVTAFTSTLDKKELQEMNDYLINI
IMKGRQAGVFMFLTAQRPDADVIKGNVRDQLGLRVSLGNLSNDGYRMTFGQTDKEFQTIHDSDIGRGYIS
ILGQYNEPILFDAPLMEQYDFVEDVKQILNKE
 
Nucleotide Sequence: 1359 bp     [Download]
>gi|49482253|ref|NC_002952.2|:c1357713-1356355 Staphylococcus aureus subsp. aureus MRSA252 chromosome, complete genome
ATGGCAATGAATGAAATTGCTTTATTTAAAGGCGTACGTATACAGCCTTATCAGAAGTATATTGATTTTA
TGTTTGCAGGTGTATTAGCATTTATTTTTTTGGTATATCGTATATACATTTTGTTTATTGATTATAAATC
AGTTAATAAAAAATTGGATATATGGACGTTGTTTGCATATTTTAAACCGCATTTATTGTATTTATTAATT
GGTACAGCAATTATATTTGTTATATGTAAGCTTATCGCTCAGCTTTTAATTCGTTTTAAAACAAAAGATT
TAGCTGAAATGATTGAAACACAAGGTTTTCATAATCGTACAGTAATCAAGAAAACAACCGAGTATATCCC
TATTGATTATAAACAAACTGAATATGACTATTATCCAACGATGTTTTATAAACGTGGTAAAAAAACTTTT
GTTATTCATATTAAAAAAGACGGTTCGAGGTTTCAAGATAATTATTTAGAGTTAGAAACGATTATTGAAC
CAATGTTTAATTCTGAATTAGTAGAAAAAAAGCATATTGGTCGTTATTTGAGATATGAATTTATGCCACT
TAAATATAAAAAGCGTATTGTTATGAATGGCGAACAAGAATCAAATACAATTTTTTATGATACAAAAATT
GCTATTACGCATCAAATTACTTGGGATTTTGTGAAAGCACCTCATGGATTGGTTACAGGTATAACCGGAG
GTGGTAAAACATATTTTTTATTTTATGTGATTCGTGAGTTATTCCGTAGACATTCAGAAGTACGTTTATT
AGATCCAAAAGTTTCAGATTTGAGCTTTATGAAGCGCGTTATTGGTGATGATAAAGTTGCAGATACTAAA
GGTCAAATATTAAAACAATTGAGAGAAGCTAATAATGAAATGGAAGAGCGTTTTAGATTAATGAATGATA
GTTCGGATTATAAAATCGGGAATGATTTCCGTAATTTTGATATGCGCCCCTATTTCATTATTTTTGATGA
GGTAACGGCTTTTACTTCAACTTTAGATAAAAAAGAATTACAAGAAATGAATGATTATTTAATTAATATT
ATTATGAAAGGTCGTCAAGCTGGTGTATTTATGTTTTTAACAGCACAAAGACCAGATGCAGATGTGATTA
AAGGTAATGTGCGTGATCAATTAGGGTTACGTGTGTCTTTAGGTAATTTGTCAAATGATGGTTATCGTAT
GACCTTTGGTCAAACTGATAAAGAATTTCAAACGATTCATGATAGTGACATCGGTCGAGGTTATATTTCT
ATACTTGGACAATATAATGAACCAATTTTATTTGATGCACCTTTAATGGAACAATATGATTTTGTGGAAG
ATGTGAAACAAATATTAAATAAGGAGTGA
 Primer design