SecReT4
Protein ID: 49483481
T4SS name [ID]Ydd [621]
Gene symbol-
Locus tagSAR1295
StrainStaphylococcus aureus subsp. aureus MRSA252
Repliconchromosome [GenBank: NC_002952] [Browse all T4SS(s) in this replicon]
Location [Strand]1360692..1360952 [-]
Producthypothetical protein
Component typeYddC
UniProt IDQ6GHB7
KEGG IDsar:SAR1295
PDB IDNA
Domain hit(s) vs Pfam NA
Protein Sequence: 86 a.a.     [Download]
>gi|49483481|ref|YP_040705.1| hypothetical protein SAR1295 [Staphylococcus aureus subsp. aureus MRSA252]
MSGLFNFLVLGADRPSLGGVGDWISNEVGTGIGLVVLVVGIVKWASGKYGHMVILFVVGGFLFLVSKGPE
QVFNAIAGVWKMIFGG
 
Nucleotide Sequence: 261 bp     [Download]
>gi|49482253|ref|NC_002952.2|:c1360952-1360692 Staphylococcus aureus subsp. aureus MRSA252 chromosome, complete genome
ATGAGTGGTTTATTTAATTTTTTAGTTTTAGGTGCTGACCGTCCATCACTTGGTGGAGTTGGTGACTGGA
TAAGTAATGAAGTGGGTACGGGTATTGGTTTAGTAGTATTGGTTGTTGGTATTGTAAAATGGGCTAGTGG
TAAATATGGGCATATGGTTATATTATTTGTTGTTGGTGGCTTTTTATTCTTAGTTTCTAAAGGTCCTGAA
CAGGTATTTAATGCGATTGCAGGTGTTTGGAAAATGATTTTTGGCGGTTGA
 Primer design