SecReT4
Protein ID: 50119504
T4SS name [ID]Tfc [699]
Gene symbol-
Locus tagECA0555
StrainPectobacterium atrosepticum SCRI1043
Repliconchromosome [GenBank: NC_004547] [Browse all T4SS(s) in this replicon]
Location [Strand]623308..624021 [+]
Producthypothetical protein
Component typeTfc3
UniProt IDQ6D9R0
KEGG IDeca:ECA0555
PDB IDNA
Domain hit(s) vs Pfam NA
Protein Sequence: 237 a.a.     [Download]
>gi|50119504|ref|YP_048671.1| unnamed protein product [Pectobacterium atrosepticum SCRI1043]
MRLKAMAMVLALAGTAHASVNTSIHVTPEANSQTRAVDQGLSRLQSTQWGLTDDEWARYQDMIRGKTGIQ
SPGLDPLTTLGIEARSDAERRQLAEKWVKEEYQRTEKILKFQREVDAAWERIYPNALPVNMGNAGGIAHD
NGGRLALFMKANDCGNCNTRLAAVLADNRPVDIYLVDSGGDDNKLREWARERNIPAERVRSRQITLNHDG
GRWIRFGNGLMPVLLQQGEDGWRVAAF
 
Nucleotide Sequence: 714 bp     [Download]
>gi|50118965|ref|NC_004547.2|:623308-624021 Pectobacterium atrosepticum SCRI1043 chromosome, complete genome
ATGAGATTGAAAGCAATGGCGATGGTGCTTGCTTTGGCAGGAACGGCACACGCCTCAGTTAATACCAGTA
TTCATGTTACACCTGAAGCGAACTCACAAACCCGAGCTGTTGATCAGGGATTATCCCGCCTTCAGTCAAC
GCAATGGGGTCTTACTGATGACGAGTGGGCGCGATATCAGGACATGATTCGAGGGAAAACCGGTATTCAA
TCCCCCGGGTTGGATCCGTTAACCACGCTAGGTATTGAAGCTCGCAGTGATGCAGAACGGCGGCAGCTAG
CAGAGAAGTGGGTTAAAGAAGAATACCAGCGAACTGAAAAGATCCTGAAGTTTCAACGTGAGGTTGACGC
TGCTTGGGAACGTATTTATCCGAATGCATTGCCCGTCAATATGGGTAACGCGGGTGGTATTGCGCATGAT
AATGGCGGCAGATTGGCACTATTTATGAAGGCTAACGATTGCGGAAATTGCAATACGCGCCTTGCTGCTG
TTCTTGCTGATAATCGCCCAGTTGATATCTACCTAGTTGATAGTGGCGGGGATGATAACAAACTGCGTGA
ATGGGCCAGAGAGCGCAATATCCCTGCCGAGCGGGTACGGAGCCGTCAGATCACATTGAACCATGATGGT
GGTCGCTGGATTCGGTTTGGCAATGGCTTGATGCCAGTATTGTTGCAACAGGGAGAAGATGGATGGCGCG
TTGCGGCATTCTGA
 Primer design