SecReT4
Protein ID: 50119505
T4SS name [ID]Tfc [699]
Gene symbol-
Locus tagECA0556
StrainPectobacterium atrosepticum SCRI1043
Repliconchromosome [GenBank: NC_004547] [Browse all T4SS(s) in this replicon]
Location [Strand]624021..624608 [+]
Producthypothetical protein
Component typeTfc4
UniProt IDQ6D9Q9
KEGG IDeca:ECA0556
PDB IDNA
Domain hit(s) vs Pfam NA
Protein Sequence: 195 a.a.     [Download]
>gi|50119505|ref|YP_048672.1| unnamed protein product [Pectobacterium atrosepticum SCRI1043]
MLIIFSIFSASVSASRQSVPDGYQRVAYLHQVPPELFYAQSLQESSRKLPHGVRPWPWSINVQGRSYQYD
SRLEAWQALQRFLKTVPHKNIDVGLGQVNWGWNGRRFANSWEAFEPYTNLNVSAQILRECYERKPDSWLR
AVGCYHHPAGGAPAARYISAVQHKLAMIESSTAASPLPEIAHATQLVWIEPRSVK
 
Nucleotide Sequence: 588 bp     [Download]
>gi|50118965|ref|NC_004547.2|:624021-624608 Pectobacterium atrosepticum SCRI1043 chromosome, complete genome
ATGCTGATTATATTCAGTATTTTCTCTGCCAGTGTTAGTGCGTCACGACAGTCAGTGCCTGACGGGTATC
AGCGTGTTGCGTATTTACATCAGGTTCCGCCTGAGCTGTTCTATGCACAATCATTACAGGAGTCTAGCCG
CAAGCTGCCTCATGGCGTTCGTCCCTGGCCCTGGAGCATTAATGTCCAGGGGAGGAGCTATCAATATGAC
AGCCGACTGGAAGCCTGGCAGGCACTACAACGTTTTTTGAAGACGGTTCCACATAAAAATATTGATGTCG
GATTAGGGCAGGTTAACTGGGGTTGGAACGGTCGTCGTTTTGCAAACTCCTGGGAGGCGTTTGAACCCTA
TACCAATCTGAATGTTTCGGCTCAAATCCTACGTGAATGCTACGAGAGAAAGCCGGACAGTTGGTTGCGT
GCGGTTGGTTGTTACCACCATCCGGCCGGTGGTGCCCCAGCGGCAAGATACATTTCTGCGGTACAGCACA
AGCTAGCCATGATTGAATCTTCGACAGCAGCTTCCCCCCTTCCTGAGATTGCTCATGCTACTCAACTTGT
CTGGATCGAACCCCGGAGCGTCAAATAA
 Primer design