SecReT4
Protein ID: 50119506
T4SS name [ID]Tfc [699]
Gene symbol-
Locus tagECA0557
StrainPectobacterium atrosepticum SCRI1043
Repliconchromosome [GenBank: NC_004547] [Browse all T4SS(s) in this replicon]
Location [Strand]624609..625130 [+]
Producthypothetical protein
Component typeTfc5
UniProt IDQ6D9Q8
KEGG IDeca:ECA0557
PDB IDNA
Domain hit(s) vs Pfam DUF2859 [PF11072], Evalue: 6.2e-50, Aligned region: 25..167
Protein Sequence: 173 a.a.     [Download]
>gi|50119506|ref|YP_048673.1| unnamed protein product [Pectobacterium atrosepticum SCRI1043]
MKIISVSALCVLAIPFFVHAELNVVADLGGKDAAPFFESINRQGNVGSNNTESSTWQGQPGEGAMLPIVT
SELTIGIETPRSLNLPGIGALFLIGDDPASRSWLQMNAAKLSQMHAVGLIVNVTDIAAVQSLRSLVPDVQ
MAPASGSELARRLQLRHYPVLITETSVSSEVQP
 
Nucleotide Sequence: 522 bp     [Download]
>gi|50118965|ref|NC_004547.2|:624609-625130 Pectobacterium atrosepticum SCRI1043 chromosome, complete genome
ATGAAAATTATTTCTGTATCTGCGCTGTGTGTGCTGGCAATCCCATTCTTTGTTCATGCGGAGCTGAATG
TTGTCGCTGATCTGGGGGGGAAAGATGCCGCGCCTTTCTTTGAGAGTATTAATCGCCAGGGCAACGTCGG
TAGCAATAATACTGAAAGCAGTACCTGGCAAGGCCAGCCGGGAGAAGGCGCTATGCTGCCGATTGTGACA
TCAGAACTGACCATTGGTATTGAAACGCCCAGATCTCTTAATTTGCCCGGCATTGGTGCGTTATTTCTCA
TTGGAGACGATCCGGCGTCGCGTTCCTGGCTACAGATGAATGCTGCAAAACTGAGTCAAATGCATGCAGT
TGGCTTAATCGTCAATGTAACGGATATTGCTGCGGTTCAGTCCCTGCGCTCACTGGTTCCTGATGTGCAG
ATGGCTCCTGCGTCAGGCAGTGAGTTAGCTCGTCGATTACAATTGCGGCATTATCCCGTGCTGATCACGG
AGACCTCTGTATCTTCAGAGGTACAACCATGA
 Primer design