SecReT4
Protein ID: 50119509
T4SS name [ID]Tfc [699]
Gene symbol-
Locus tagECA0560
StrainPectobacterium atrosepticum SCRI1043
Repliconchromosome [GenBank: NC_004547] [Browse all T4SS(s) in this replicon]
Location [Strand]626208..628304 [+]
Productplasmid transfer protein
Component typeTfc6
UniProt IDQ6D9Q5
KEGG IDeca:ECA0560
PDB IDNA
Domain hit(s) vs Pfam TraG-D_C [PF12696], Evalue: 3.9e-16, Aligned region: 504..632
TrwB_AAD_bind [PF10412], Evalue: 1.7e-15, Aligned region: 178..225
TrwB_AAD_bind [PF10412], Evalue: 1.7e-15, Aligned region: 484..642
AAA_10 [PF12846], Evalue: 3.6e-11, Aligned region: 187..225
AAA_10 [PF12846], Evalue: 3.6e-11, Aligned region: 398..578
Protein Sequence: 698 a.a.     [Download]
>gi|50119509|ref|YP_048676.1| unnamed protein product [Pectobacterium atrosepticum SCRI1043]
MSDRYVIEALLRPAVELNTAVVSATAAFVCVQAPWAIALAPSVSYVTAGGFAVLAMVRTRQGMKVLRYRR
NLRRLPRYVMSSKQIPVSKRRLFIGKGFMWTQKHTQRLRDTLRPEVERYIQPPTLYQAARKLENAAEHNL
PWLTKLLSVDSPLNPVRPLPPVGGKPVLHGIEPDEVDVTMPLADRPGHTIVLGTTRVGKTRLAELFITQD
IRRGDVTIVFDPKGDPDLLRRVWAEAHRAGRGDSLYIFHLGWPEISARYNAVGRFGRVSEVASRISGQLA
GEGNSAAFKEFAWRFVNIVARALVALGERPDYTLIMRYVNNIADLYLRYAEKIIEEELPELQLQIRNNLG
VFTDEDVPRNMQGQPNSVGIWAIEVALSSEAGKKLYDPILDGLRSAVRYDRTYFDKIVASLLPLLEKLTT
GKTASLLSPDYLDMDDSRPIFDWEQIVRKRGVVYIGLDALTDSEVATAVGNSMFADLVSVAGHIYKHGIN
AGLPQQKEEKAVINLHCDEFNELMGDEFIPLINKGGGAGVQVTAYTQTSSDIEARIGNAAKTAQVIGNFN
TLIMLRVRDNKTAELLTTQLPQVEIYSKTLVSGHSDTANVETGQDFTSSTQDRVGTIKTPLIEPSDVVSL
PKGQAFALLEGGQLWKIRMPLPTNDIDDAMMPANLQAVATEMRRNYHSSEGWWSGRSLTAADRQVGGE
 
Nucleotide Sequence: 2097 bp     [Download]
>gi|50118965|ref|NC_004547.2|:626208-628304 Pectobacterium atrosepticum SCRI1043 chromosome, complete genome
ATGAGCGATCGTTATGTCATTGAGGCATTGCTGCGGCCCGCTGTTGAACTGAACACTGCCGTAGTTTCGG
CTACAGCAGCATTTGTCTGTGTGCAGGCACCATGGGCGATTGCGTTGGCCCCTTCAGTCAGTTATGTGAC
GGCCGGTGGGTTCGCTGTTCTGGCCATGGTACGAACCCGCCAGGGAATGAAGGTACTGCGTTACCGTCGT
AATTTACGACGCCTACCACGTTACGTGATGAGTAGTAAGCAGATCCCTGTAAGTAAACGGCGGTTGTTTA
TCGGTAAGGGATTTATGTGGACGCAGAAACACACCCAACGGCTGCGTGACACGTTACGTCCGGAGGTCGA
GCGTTATATTCAGCCGCCAACCCTGTATCAGGCCGCCCGTAAACTAGAGAATGCAGCAGAGCATAACTTG
CCCTGGCTCACGAAACTACTGAGCGTAGATTCTCCTCTGAACCCAGTGCGCCCATTACCGCCCGTCGGTG
GAAAGCCGGTACTACATGGTATTGAGCCTGATGAGGTTGATGTCACTATGCCACTGGCCGATCGCCCCGG
TCATACCATCGTATTGGGTACGACTCGTGTTGGAAAAACACGGTTGGCCGAACTGTTTATTACCCAGGAT
ATCCGCCGTGGTGATGTGACGATTGTCTTCGATCCAAAGGGTGACCCTGATTTATTACGTCGAGTCTGGG
CTGAAGCGCACCGTGCCGGGCGAGGTGATTCGCTCTACATCTTCCATCTGGGTTGGCCCGAAATATCAGC
TCGTTATAACGCCGTTGGACGGTTTGGGCGTGTCTCTGAAGTGGCGTCGCGTATCTCTGGGCAATTGGCG
GGGGAAGGGAACAGTGCTGCATTTAAAGAGTTTGCGTGGCGTTTCGTAAATATTGTAGCCAGAGCACTGG
TTGCATTGGGTGAGCGGCCTGACTACACGCTAATTATGCGTTACGTCAATAATATTGCGGACCTGTATCT
ACGCTATGCTGAGAAAATCATTGAAGAGGAACTACCCGAGCTACAACTGCAGATACGCAATAACTTAGGG
GTATTCACTGATGAAGATGTTCCCCGAAATATGCAGGGCCAGCCTAATAGCGTTGGCATTTGGGCAATAG
AGGTTGCGTTAAGCTCAGAGGCCGGTAAGAAACTCTATGATCCGATTTTGGATGGCTTGCGCTCTGCGGT
TCGCTATGACAGAACTTATTTCGACAAAATTGTTGCCTCTTTATTACCATTATTGGAGAAACTGACGACG
GGTAAAACGGCGTCCCTGTTGTCGCCGGACTATCTGGATATGGATGACTCACGCCCCATTTTTGATTGGG
AACAAATTGTTCGCAAACGAGGTGTTGTGTATATCGGTCTGGACGCCCTTACAGACAGTGAAGTTGCTAC
GGCAGTGGGGAACAGCATGTTTGCCGATCTGGTTAGCGTGGCTGGCCATATTTATAAACATGGTATTAAT
GCTGGACTGCCACAGCAGAAAGAAGAAAAAGCCGTCATTAACCTGCATTGCGATGAGTTCAATGAGCTAA
TGGGTGATGAATTCATTCCGTTGATCAACAAAGGCGGTGGTGCTGGCGTTCAAGTGACCGCCTATACGCA
AACTTCATCAGATATCGAGGCGCGTATCGGGAATGCTGCGAAAACGGCTCAGGTCATTGGTAACTTCAAT
ACACTGATCATGCTGCGTGTCCGGGACAACAAAACTGCAGAATTGCTCACGACACAGCTGCCGCAGGTTG
AGATCTACAGTAAAACGTTGGTTTCTGGTCACTCGGATACGGCTAATGTTGAGACTGGACAGGATTTTAC
ATCCAGTACTCAGGATCGTGTTGGTACGATAAAAACCCCGTTGATTGAGCCGTCTGATGTCGTCAGCCTG
CCTAAAGGCCAGGCGTTCGCCCTGCTTGAAGGTGGTCAGTTGTGGAAAATCAGGATGCCGCTGCCGACCA
ATGATATTGATGATGCGATGATGCCAGCAAACTTGCAGGCTGTGGCGACAGAAATGCGCCGTAACTATCA
TTCCAGTGAGGGATGGTGGAGCGGGCGTTCACTTACTGCTGCAGATCGGCAAGTGGGAGGTGAGTAG
 Primer design