SecReT4
Protein ID: 50119510
T4SS name [ID]Tfc [699]
Gene symbol-
Locus tagECA0561
StrainPectobacterium atrosepticum SCRI1043
Repliconchromosome [GenBank: NC_004547] [Browse all T4SS(s) in this replicon]
Location [Strand]628306..629061 [+]
Producthypothetical protein
Component typeTfc8
UniProt IDQ6D9Q4
KEGG IDeca:ECA0561
PDB IDNA
Domain hit(s) vs Pfam DUF4400 [PF14348], Evalue: 3.2e-71, Aligned region: 48..248
Protein Sequence: 251 a.a.     [Download]
>gi|50119510|ref|YP_048677.1| unnamed protein product [Pectobacterium atrosepticum SCRI1043]
MAEPARNPPPQKPERPHGLLYHVLWGWPWKLIGIVLGSLLLSLLIEYVGIAFFWPTEGAAHSQQVMNTEL
GYLSSEFKRSLLFSEPSVTVIHWINTGYHWAFINSGFMDWVSNQYQMQAKSHSELGRSLNAWSGWLAQSL
REYLLATVYVTVVTLVRVTILFLSIPLFAMVVIVAIVEGLGRRDLRRFGAGYESSFLYHHAKRLVKPAFY
VPAMLYLSWPMAVYPNLLLLPAALLFGTAITVTTATFKKYL
 
Nucleotide Sequence: 756 bp     [Download]
>gi|50118965|ref|NC_004547.2|:628306-629061 Pectobacterium atrosepticum SCRI1043 chromosome, complete genome
ATGGCTGAACCTGCACGTAATCCTCCCCCACAAAAACCAGAGCGACCACATGGATTGCTTTATCACGTGT
TGTGGGGCTGGCCATGGAAGTTGATTGGCATTGTTCTCGGCTCGTTATTGCTGAGCCTGCTGATTGAGTA
CGTGGGCATTGCATTCTTCTGGCCTACAGAAGGGGCGGCACACAGTCAGCAGGTGATGAACACTGAACTG
GGCTATTTATCGTCAGAATTCAAGCGTAGTCTGTTGTTTTCCGAGCCCTCTGTCACCGTAATCCATTGGA
TCAACACCGGCTATCACTGGGCGTTTATCAACAGTGGCTTTATGGATTGGGTTAGTAACCAATATCAGAT
GCAGGCAAAAAGTCATAGTGAGCTAGGGCGTAGCTTAAACGCCTGGAGTGGTTGGCTGGCACAATCATTG
CGGGAATATTTGCTGGCTACTGTATATGTCACGGTAGTTACCTTGGTTAGGGTCACCATCCTGTTTCTCT
CGATACCCTTGTTTGCGATGGTGGTAATTGTGGCCATTGTCGAAGGGCTGGGGCGGCGTGACCTGCGGCG
CTTTGGTGCAGGCTATGAATCCAGTTTTCTCTATCACCATGCCAAACGCTTGGTTAAACCTGCGTTTTAT
GTACCCGCTATGCTGTATTTGTCCTGGCCTATGGCGGTCTACCCTAACTTATTATTATTGCCGGCAGCGT
TGCTATTTGGTACTGCGATTACAGTAACAACGGCCACATTTAAAAAATATCTTTGA
 Primer design