SecReT4
Protein ID: 50119513
T4SS name [ID]Tfc [699]
Gene symbol-
Locus tagECA0564
StrainPectobacterium atrosepticum SCRI1043
Repliconchromosome [GenBank: NC_004547] [Browse all T4SS(s) in this replicon]
Location [Strand]630094..630414 [+]
Producthypothetical protein
Component typeTfc9
UniProt IDQ6D9Q1
KEGG IDeca:ECA0564
PDB IDNA
Domain hit(s) vs Pfam Plasmid_RAQPRD [PF09686], Evalue: 3.1e-31, Aligned region: 19..101
Protein Sequence: 106 a.a.     [Download]
>gi|50119513|ref|YP_048680.1| unnamed protein product [Pectobacterium atrosepticum SCRI1043]
MFYPFLRLVCLLGASLLFTHSASASEKDELASTQRLLDQVQASLERARVVAAQSDPADRARYHFDYQRIT
ADLNAIRAGIDTYLAPSRAQPREASSIAGNYRREQP
 
Nucleotide Sequence: 321 bp     [Download]
>gi|50118965|ref|NC_004547.2|:630094-630414 Pectobacterium atrosepticum SCRI1043 chromosome, complete genome
ATGTTTTATCCCTTTCTCCGGCTTGTTTGCCTTCTCGGTGCTTCATTGCTGTTTACCCATTCTGCAAGCG
CATCAGAGAAAGACGAGCTGGCCAGCACGCAACGCCTACTCGATCAGGTCCAGGCCTCGCTGGAACGTGC
TCGCGTTGTTGCTGCGCAATCTGACCCCGCCGATCGTGCCCGATACCATTTTGACTATCAACGTATTACT
GCGGATTTGAATGCCATTAGAGCAGGTATTGATACCTATCTGGCGCCATCCCGGGCGCAGCCGCGTGAAG
CCAGTTCCATTGCGGGAAACTACCGGCGGGAGCAGCCCTGA
 Primer design