SecReT4
Protein ID: 50119516
T4SS name [ID]Tfc [699]
Gene symbol-
Locus tagECA0567
StrainPectobacterium atrosepticum SCRI1043
Repliconchromosome [GenBank: NC_004547] [Browse all T4SS(s) in this replicon]
Location [Strand]631033..631395 [+]
Producthypothetical protein
Component typeTfc11
UniProt IDQ6D9P8
KEGG IDeca:ECA0567
PDB IDNA
Domain hit(s) vs Pfam DUF3487 [PF11990], Evalue: 1.3e-42, Aligned region: 2..118
Protein Sequence: 120 a.a.     [Download]
>gi|50119516|ref|YP_048683.1| unnamed protein product [Pectobacterium atrosepticum SCRI1043]
MRTIPFLPDRLNAEPVVFRGFTTPELGLAALFGILAGLLWSIFLISLAGWVIIPTGILLTPLLVVGFGGN
WIARIKRGKPENYIWQKLGEKKRRFGLGEGTLIIHSQGWSLRRSQSKGRS
 
Nucleotide Sequence: 363 bp     [Download]
>gi|50118965|ref|NC_004547.2|:631033-631395 Pectobacterium atrosepticum SCRI1043 chromosome, complete genome
ATGCGGACCATTCCTTTTTTACCCGATCGCCTGAATGCCGAACCCGTGGTGTTTCGAGGGTTTACCACGC
CAGAGTTGGGGCTTGCTGCGTTGTTTGGGATTCTTGCTGGCCTCCTGTGGTCCATATTTCTTATTTCTCT
TGCTGGATGGGTCATTATCCCTACAGGGATATTATTGACCCCTTTATTGGTGGTTGGCTTCGGTGGCAAT
TGGATAGCACGAATTAAACGCGGTAAACCTGAGAACTACATCTGGCAAAAGTTGGGAGAAAAGAAACGGC
GATTTGGGTTGGGGGAGGGGACGTTGATTATTCACTCTCAGGGATGGTCATTACGCCGTAGCCAATCTAA
GGGACGATCATGA
 Primer design